KEGG   Brevundimonas sp. GW460-12-10-14-LB2: A4249_11955Help
Entry
A4249_11955       CDS       T04395                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
brg  Brevundimonas sp. GW460-12-10-14-LB2
Brite
KEGG Orthology (KO) [BR:brg00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    A4249_11955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 LTD
Motif
Other DBs
NCBI-ProteinID: ANC54300
UniProt: A0A168NNS5
Position
complement(2400249..2400656)
Genome map
AA seq 135 aa AA seqDB search
MHDGPAYTAETNGILIRVRPSYLAGQSDPDEGRWVWAYQIEIVNLTGSTVQLMARRWTIT
DGHGHVEEVRGPGVVGEQPVIEPGGSYAYASGCPLGTDSGSMVGAYYMTDADGRSFEAQI
PAFSLDTPDARRVLN
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgcacgatggtcctgcctataccgccgagacgaacggcatcctgatccgggtgcgcccc
agctatctggcgggccagtccgatcccgacgaaggccgctgggtctgggcctaccagatc
gagatcgtgaacctgacgggctcgacggtgcaactaatggcgcgtcgctggaccatcacc
gacggccacggccatgtggaagaggtgcgcgggccgggcgtcgtcggcgaacagccggtg
atagaaccgggcggcagctacgcctacgcctcgggctgtccgctgggcaccgacagcggt
tcgatggtgggcgcctattatatgacggatgcggacgggcgcagtttcgaggcgcagatt
ccggcgttttcgcttgatacgccggatgcgcggcgggtgctgaactga

DBGET integrated database retrieval system