KEGG   Paraburkholderia rhizoxinica: RBRH_00187Help
Entry
RBRH_00187        CDS       T01355                                 

Definition
(GenBank) Tryptophan synthase alpha chain (EC 4.2.1.20)
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
brh  Paraburkholderia rhizoxinica
Pathway
brh00260  Glycine, serine and threonine metabolism
brh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
brh01100  Metabolic pathways
brh01110  Biosynthesis of secondary metabolites
brh01130  Biosynthesis of antibiotics
brh01230  Biosynthesis of amino acids
Module
brh_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:brh00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RBRH_00187
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RBRH_00187
Enzymes [BR:brh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RBRH_00187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA Peripla_BP_6 PcrB His_biosynth
Motif
Other DBs
NCBI-ProteinID: CBW75601
UniProt: E5ASL9
Position
complement(2034880..2035683)
Genome map
AA seq 267 aa AA seqDB search
MSRIKTKFAALTRDRRKGLIPFMTAGDPDPARTVEFMHALAAGGADVIELGVPFSDPMAD
GPVIQRSSERALARGITLRRVLDDVRVFRERDRDTPVVLMGYANPIERMGREAFGAAARE
AGVDGVLVVDYPPEEAAEFADTMRGYGIDPIFLLAPTSTDERIAAVGRVASGYVYYVSLR
GVTGAANLDVSSIAGKMPAIKARVPLPIGVGFGIRDAATARAIAEVSDAVVIGSRIVQLL
EQTPGQDAAHVLKAFVAEVRHALDHAV
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgaattaaaacgaagtttgcggcgctgacccgcgatcgacgcaagggcctgatt
ccattcatgaccgcgggcgacccggatccggcgcgcaccgtcgagttcatgcacgcgctg
gccgctggcggcgccgacgtgatcgagctgggtgtgccattctcggacccgatggccgat
ggccccgtgattcagcgctcgtccgagcgggcactggcgcgcggcatcacgctgcggcgc
gtgctcgacgacgtgcgcgtgtttcgcgagcgcgaccgtgacacacccgtggtgctgatg
ggatacgcgaacccgatcgagcggatggggcgcgaggcgttcggcgccgcggcgcgcgag
gccggtgtcgatggtgtgctggtggttgactacccgcccgaggaagcggctgaattcgcc
gataccatgcgtggctacggcatcgatccgatcttcctgctcgcgccgacgtccaccgac
gagcgcattgccgcggtgggacgcgtggcgagcggctatgtctattatgtgtcgctcagg
ggcgtgaccggtgcggcaaatctcgacgtttccagcatcgcaggtaaaatgccagccatc
aaggcgcgagtgcctttgccgattggagtcggctttggtattcgcgatgccgccacggcc
cgtgcaatcgccgaggtcagcgacgcggtcgtgatcggcagccgcattgtccaactgctc
gagcagacgcccgggcaggacgccgcgcacgtgctcaaggcgtttgttgccgaggtgcgg
cacgcgctggaccacgcggtctga

DBGET integrated database retrieval system