KEGG   Paraburkholderia rhizoxinica: RBRH_00203Help
Entry
RBRH_00203        CDS       T01355                                 

Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase (EC 4.1.3.39)
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
brh  Paraburkholderia rhizoxinica
Pathway
brh00360  Phenylalanine metabolism
brh00362  Benzoate degradation
brh00621  Dioxin degradation
brh00622  Xylene degradation
brh01100  Metabolic pathways
brh01120  Microbial metabolism in diverse environments
brh01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:brh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    RBRH_00203
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RBRH_00203
   00622 Xylene degradation
    RBRH_00203
   00621 Dioxin degradation
    RBRH_00203
Enzymes [BR:brh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     RBRH_00203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm DUF3866
Motif
Other DBs
NCBI-ProteinID: CBW75584
UniProt: E5ASK2
Position
complement(2019014..2020093)
Genome map
AA seq 359 aa AA seqDB search
MRRFDRAPPPRHGHGARPSGDRTMSHTGKKLYISDVTLRDGSHAIRHQYSVENVRAIAAA
LDRAGVDSIEVAHGDGLQGSSFNYGFGAHSDVEWIEAAAQSVTRAQIATLLLPGIGTIHD
LRNAYDAGARIVRVATHCTEADVSRQHLEYARELGMDPVGFLMMSHMTTPQKLAEQALLM
ESYGASCIYVVDSGGALGMNDVRDRFRALKEVLRADTQTGIHAHHNLSLGVANSLVALEE
GCDRIDASLAGMGAGAGNAPLEVFIAAADKQGWNHGCDLYQLMDAADDLVRPLQDRPVRV
DRETLALGYAGVYSSFLRHAEVAAQKYGLKTVDILVELGRRKMVGGQEDMIVDVALDLR
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgatttgatcgcgcgccgccgcctcgacacgggcatggcgcgcggccatcggga
gaccgcacaatgagccacaccggcaagaaactgtatatctccgacgtgacgttgcgcgac
ggcagtcacgccatacggcaccagtacagcgtggagaacgtgcgcgcgatcgcggccgcg
ctggaccgtgccggcgtggacagcattgaggtcgcgcatggcgacgggctgcaaggctct
agcttcaactatggatttggcgcgcacagcgacgttgaatggatcgaggccgccgcgcaa
agcgtgacgagggcccaaatcgccacgctgctgttgcctggcatcggcacgatccacgac
ctgcgcaatgcgtacgacgccggcgcacgtatcgtgcgcgtggcgacgcactgtaccgag
gccgatgtctcgcgacaacacctggagtacgcccgggaactgggcatggacccggtcggt
ttcctgatgatgagccacatgaccacgccgcagaagctggccgagcaagcgctgctgatg
gaaagctatggcgcgagctgtatctatgtggtcgactccggtggcgcgctcggcatgaac
gacgtgcgtgaccggttccgcgcgctgaaggaggtgttgcgtgccgatacgcagaccggc
atccacgcgcaccataacctgagtcttggcgtggccaattcgctggttgcgctcgaagaa
ggatgtgaccgcatcgatgcgagcctagccggaatgggtgccggggcgggcaatgcgccg
ctcgaggtattcattgcggctgctgacaagcagggctggaaccacggttgcgacctgtac
cagctgatggacgcagccgatgacctggtgcggccgttgcaagaccgtccggtgcgcgtc
gatcgcgaaacgcttgcgcttggctatgccggcgtgtattcgagttttctgcgtcatgct
gaggtggccgctcagaagtacggcctgaagaccgttgacattctggttgaacttggccgc
cgcaagatggtgggcggccaggaagacatgatcgtcgacgtcgcgcttgatcttcgctag

DBGET integrated database retrieval system