KEGG   Paraburkholderia rhizoxinica: RBRH_00650Help
Entry
RBRH_00650        CDS       T01355                                 

Definition
(GenBank) CONJUGAL TRANSFER PROTEIN TRAN
  KO
K12058  conjugal transfer mating pair stabilization protein TraN
Organism
brh  Paraburkholderia rhizoxinica
Brite
KEGG Orthology (KO) [BR:brh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:brh02044]
    RBRH_00650
Secretion system [BR:brh02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   RBRH_00650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraN Gly_rich_SFCGS
Motif
Other DBs
NCBI-ProteinID: CBW77307
UniProt: E5AW05
Position
pBRH02:68937..70220
Genome map
AA seq 427 aa AA seqDB search
MRNVRAKSAMIKRLLVAMIFLAWGSKLAVAGDCQRLSSVCIDATPVKNIQGLNITVDQVG
GCWAFEDTYQCRSAATVNDCQSLRDRGCVQIGATCVDKDDAGTCVMYEFSYQCPDKPETY
TERTVCDQSAFCQDSKAMCFDTSAPPDEDFGQAAVMMEAVREAGVYGVDPDKVEIFKGYM
EQCSIKVLGGATLKSCCKSTGGGEKFSNYQLLGAGVAVAGQAGREAVAMGSKYVYDALYG
QLDSALMKKGLGAMNNWASVVGDGMLNPQFGFYGFTFEFSLVNGFQFVGFDPSSFALQIG
IMLVQEWLACDSSEQAMSMKRGQNLCAHVETYCSKKVLKVCVEKKERHCCFNSKLAKIIN
RQGRAQLGMAMNSCSGFNEAQLKALDFSRIDLSEFIADMIPKDANLPQMTNRVQQTVSDK
VQGYYDQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaacgttagagcaaagagcgcaatgataaaaaggctgcttgttgcgatgattttc
ttggcgtggggctccaagctggcagtcgccggtgactgccagcgcctatccagcgtgtgc
attgacgcgacccccgtcaaaaacatccaaggcctgaacatcacggtcgatcaggtagga
ggttgttgggccttcgaagatacctaccaatgccgtagtgctgcgacggtaaacgactgt
caatcgttgcgcgaccgcggctgcgtacaaataggggcgacatgtgtcgacaaagacgat
gccggtacgtgtgtgatgtatgaatttagctatcaatgtcccgataagcccgaaacttac
accgagcgcaccgtgtgcgaccaaagcgccttttgccaggatagcaaggcaatgtgcttc
gacaccagtgcaccgcccgatgaggattttggccaagccgcagtgatgatggaggccgtc
cgtgaagccggcgtctacggcgtcgatccggataaggtcgaaatctttaagggctatatg
gagcagtgcagtatcaaagtgctaggcggtgccacactcaagagctgctgtaagagcaca
ggcggtggcgaaaagttcagcaactaccagctgcttggtgcgggcgtagcggttgctggt
caggccggccgcgaggcggtggcgatgggctcgaaatacgtctacgacgcgctctatggg
cagttagacagcgccttgatgaagaagggcttgggtgcgatgaacaactgggcgtctgtt
gttggcgacggcatgttgaatccgcaattcggcttttacgggttcacttttgagttcagt
ttagtcaatggttttcaattcgtcggattcgatccttcgagcttcgctttgcagattggg
atcatgctcgttcaagagtggctggcttgcgattcaagcgagcaggccatgtcgatgaag
cgcggccaaaatctttgcgcccacgtcgaaacgtactgcagcaagaaggtgctcaaagtc
tgcgtggagaagaaagagcgacattgctgttttaactcgaagctggccaagatcattaac
cgacagggtcgcgcccaactcggcatggccatgaatagctgcagcggtttcaacgaagcg
caacttaaagcactcgacttctcgcgaatcgacttgtccgagttcatcgcggacatgatt
cccaaagacgccaatctgccccaaatgaccaatagggtccagcagaccgtgagcgacaaa
gtgcaggggtattatgaccaatga

DBGET integrated database retrieval system