KEGG   Paraburkholderia rhizoxinica: RBRH_00651
Entry
RBRH_00651        CDS       T01355                                 

Definition
(GenBank) conjugative transfer aggregate stability protein
Organism
brh  Paraburkholderia rhizoxinica
SSDB
Other DBs
NCBI-ProteinID: CBW77306
UniProt: E5AW04
Position
pBRH02:67891..68967
AA seq 358 aa
MRVFYFATLAVLAAIAARAENSINTQADAFNAGKAFANDAKDAAVGKVNGDTGSQQLPYY
GTSAPEAAHFQGGRNLIGANGTNKQNACQSYRASDAFQQQECDAVNFLSKTPATRPKYTI
DKKTDPLLTGSKSVIDNPGPVPGAHTQRCRVEKVIHPATFITETCTESQTLENVKCRRGF
SANVGTIVETPYFEVDHGVNVPPWTAQTYTMNFHVNGNPERLILTWYRVDNYGQLWINGT
KVFENVLSGYGDMRWGSVGQELIGRGLRRQRRIVYKDRHGVSMGHFYDDGCNWGCLGVSP
NLDITPHFKEGNNEIVLVCANANDIGPCTVKIVGSAKRLVMLGSLIDNQCATLEQRAQ
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgcgtgtcttttatttcgctacgctggccgtgcttgctgctattgccgcgcgtgccgaa
aattccatcaacactcaagctgacgcctttaacgccggcaaggcatttgccaatgatgca
aaggacgccgcggtcggcaaggtcaatggcgacactggcagtcagcagttgccttactac
ggaactagcgcgccggaggccgcgcattttcaaggcgggcgcaatttaatcggcgcgaac
ggcacgaataagcaaaatgcctgccaatcctacagagcttccgacgcctttcagcaacag
gaatgcgatgcggtcaattttttgtcgaagacgccggctacccggcccaagtacaccatc
gacaagaaaacggatccgttattaacgggttcaaaatccgtcatcgacaacccaggtccc
gtgccgggagcccatactcagcgatgccgggtggagaaagtcattcacccagcgacattc
atcaccgaaacctgtacagaatctcaaacgcttgagaacgtgaaatgcaggcggggtttt
tcagcaaacgtcggcacgatagtcgaaaccccgtattttgaggttgatcacggcgtcaac
gtgcctccatggacggcgcaaacgtacacgatgaattttcacgtcaacggcaacccggag
cgccttatactgacttggtatcgggttgataattacggtcaactgtggatcaatggcact
aaggtcttcgaaaacgtgctcagtggctacggcgatatgcgttggggcagcgtcggtcaa
gaattaatcggcaggggattgcggcgccagcgaagaattgtttataaagatcgccatggc
gtctcgatgggccacttctatgatgatgggtgtaattggggttgccttggtgtgtcgccc
aatctcgatattacgccgcactttaaggagggcaataacgagatcgttttggtttgtgca
aacgcgaacgatattggcccctgcacggtaaaaatcgtcggcagcgccaaaaggttggtc
atgctaggctcgctcattgataaccaatgcgcaacgttagagcaaagagcgcaatga

DBGET integrated database retrieval system