KEGG   Paraburkholderia rhizoxinica: RBRH_00663Help
Entry
RBRH_00663        CDS       T01355                                 

Definition
(GenBank) unnamed protein product
  KO
K12068  conjugal transfer pilus assembly protein TraL
Organism
brh  Paraburkholderia rhizoxinica
Brite
KEGG Orthology (KO) [BR:brh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:brh02044]
    RBRH_00663
Secretion system [BR:brh02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   RBRH_00663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraL Cas_Cmr5
Motif
Other DBs
NCBI-ProteinID: CBW77293
UniProt: E5AVZ1
Position
pBRH02:57645..57944
Genome map
AA seq 99 aa AA seqDB search
MAMSERTDLSHYIPRRLDDAPKFLFWELDIAGIGLMGVLAGIATGFPILGLGLGVATAFF
YSKLKTGKHPGIATHLLYWFTGFPQPKELPGSHIRELNG
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
gtggctatgtcagaaagaaccgatctttcccactacatcccgaggcgtttggacgatgcc
cccaagttcctattctgggagttggacattgctggcattggcttaatgggtgtcttggca
ggcattgccacgggctttcccattcttggtctgggtcttggagttgcaactgcgtttttc
tacagcaagcttaagacaggcaagcacccgggcatagccacccacctcttgtactggttc
accgggttcccgcagcccaaggagctgccgggtagccatatccgagaactcaacggatag

DBGET integrated database retrieval system