KEGG   Paraburkholderia rhizoxinica: RBRH_01957Help
Entry
RBRH_01957        CDS       T01355                                 

Definition
(GenBank) Alcohol dehydrogenase (EC 1.1.1.1)
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
brh  Paraburkholderia rhizoxinica
Pathway
brh00010  Glycolysis / Gluconeogenesis
brh00071  Fatty acid degradation
brh00350  Tyrosine metabolism
brh00625  Chloroalkane and chloroalkene degradation
brh00626  Naphthalene degradation
brh01100  Metabolic pathways
brh01110  Biosynthesis of secondary metabolites
brh01120  Microbial metabolism in diverse environments
brh01130  Biosynthesis of antibiotics
brh01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:brh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RBRH_01957
  Lipid metabolism
   00071 Fatty acid degradation
    RBRH_01957
  Amino acid metabolism
   00350 Tyrosine metabolism
    RBRH_01957
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RBRH_01957
   00626 Naphthalene degradation
    RBRH_01957
Enzymes [BR:brh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RBRH_01957
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N TrkA_N AlaDh_PNT_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: CBW73784
UniProt: E5ALB1
Position
complement(233200..234231)
Genome map
AA seq 343 aa AA seqDB search
MAMKQSMKAAVVHAFGEPLRIEEVAVPTPGPAQILVNVKASGVCHTDLHAADGDWPVKPT
LPFIPGHEGVGYVAAVGKGVKIAKEGDRVGVPWLYTACGHCEYCLGGWETLCHVQQNTGY
SVNGGYAEYVLADPNYVGRLPDQVAFDEIAPILCAGVTVYKGIRVTDTRPGQWLAISGIG
GLGHVAVQYANAMGLHVVAVDVVPDKLELAKRLGAKLVVDASATDPAAFIQKEIGGVHGV
LVTAVSRSAFAQALGMVRRGGTVSLNGLPPGDFPLPIFSTVLNAITVRGSIVGTRRDLQE
ALDFAAQGLVHAHIHHERLENINLVFGKLREGKVDGRIVLTLD
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
gtggccatgaagcaatcgatgaaggccgcggtcgtgcatgcgtttggtgagccgctgcgg
attgaagaagtcgcggtgccgacgccgggtcccgctcagatactggtcaatgtcaaagcg
tccggagtctgccacactgacctgcatgcggccgacggcgactggccggtcaagcccacg
ctgccatttatcccaggccacgagggcgtcggctacgtcgccgcagtcggaaaaggggtc
aagatcgccaaagaaggcgaccgggtcggcgtaccgtggctctacaccgcatgcggacac
tgcgagtattgcctgggcggctgggaaacgctgtgtcacgtgcagcaaaacaccggttat
tcggtcaatggcggctatgccgaatatgtattggctgacccgaattatgtcggtcggctc
ccggaccaggtcgccttcgatgagatcgcgcctattctgtgtgccggcgtcaccgtctac
aaaggcatacgggtcaccgacacgcgtccaggccaatggctggcgatatcaggcatcggc
ggattagggcatgtcgctgtgcaatatgcgaacgcgatgggtttgcatgttgtcgcggtt
gatgttgtgccggacaaactggagttggcaaaacggcttggcgccaaactcgtcgtggac
gcgtcagccaccgatccagcagcgttcattcagaaagaaatcggcggcgtacacggcgtg
ctggttaccgcggtgtcacgcagtgcgttcgctcaggcgctcggcatggtgcgacgcggt
ggcaccgtatcgcttaatggtctgccgccgggcgactttccactgccgattttttcgacg
gtgctcaatgccatcaccgtacgcggctcgatcgtcggtacgcggcgcgacctgcaggaa
gcgctcgatttcgcggcgcaggggctggtgcacgcgcacatccaccacgaacgactggag
aacatcaatttggtgtttggcaagctgcgcgaaggtaaggtcgacgggcgtatcgtgctg
acgctcgattga

DBGET integrated database retrieval system