KEGG   Paraburkholderia rhizoxinica: RBRH_02367Help
Entry
RBRH_02367        CDS       T01355                                 

Definition
(GenBank) LSU ribosomal protein L22P
  KO
K02890  large subunit ribosomal protein L22
Organism
brh  Paraburkholderia rhizoxinica
Pathway
brh03010  Ribosome
Brite
KEGG Orthology (KO) [BR:brh00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    RBRH_02367
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:brh03011]
    RBRH_02367
Ribosome [BR:brh03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    RBRH_02367
  Bacteria
    RBRH_02367
  Archaea
    RBRH_02367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 PAS_10
Motif
Other DBs
NCBI-ProteinID: CBW74557
UniProt: E5APM5
Position
962288..962617
Genome map
AA seq 109 aa AA seqDB search
MEVKAIHRGARISAQKTRLVADQIRGLPVDKALNILTFSPKKAAGIVKKVVLSAIANAEH
NEGADIDELKIKTIYVDKAASLKRFTARAKGRGNRIEKQSCHITVTVGN
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgaaggcaattcatcgcggtgcccgcatttcggcgcagaagacgcgccttgtg
gccgaccagattcgcggtttgccggttgacaaggccctaaatattctgacgttttcgccg
aagaaagcggcgggtatcgtcaagaaggtggtgctgtcggcgatcgccaatgcggaacac
aacgagggtgcagacatcgacgagttgaagatcaagacgatctacgtcgacaaggcagct
tcgctgaagcgtttcaccgcgcgcgcgaagggtcgtggcaaccgtatcgagaagcaatcc
tgtcacatcactgtgacggtcgggaattaa

DBGET integrated database retrieval system