KEGG   Paraburkholderia rhizoxinica: RBRH_02381Help
Entry
RBRH_02381        CDS       T01355                                 

Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
brh  Paraburkholderia rhizoxinica
Brite
KEGG Orthology (KO) [BR:brh00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    RBRH_02381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: CBW74702
UniProt: E5AQ20
Position
1082766..1083140
Genome map
AA seq 124 aa AA seqDB search
MSQYELSVSAQAAYLPDQSDPERQQYAFAYTLTIRNTGQVASQLIARHWIITDSDAKVQE
VKGLGVVGHQPLLQPGEQFEYTSWAVIATPVGTMRGEYFCVAEDATRFEVPVAEFALCMP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagtacgaattgagcgtctcggcacaggcggcctatctgccggaccagtccgat
ccagagcgccagcaatatgcgttcgcctacacgttgacaatacgcaacacgggacaggtt
gcctcgcagctgattgcgcgccattggatcatcaccgacagcgacgcgaaggtgcaagag
gtcaaagggctcggggtcgtcgggcatcagccgttgttgcagccgggcgagcaattcgaa
tatacgagttgggcggtcattgcgacgccggtgggcacgatgcgcggcgagtacttttgt
gtggccgaggacgctacgcgcttcgaggtgccggtagcggaattcgcgctgtgcatgccg
cgcacgctgcattga

DBGET integrated database retrieval system