KEGG   Paraburkholderia rhizoxinica: RBRH_03710Help
Entry
RBRH_03710        CDS       T01355                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase (EC 2.3.1.9)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
brh  Paraburkholderia rhizoxinica
Pathway
brh00071  Fatty acid degradation
brh00072  Synthesis and degradation of ketone bodies
brh00280  Valine, leucine and isoleucine degradation
brh00310  Lysine degradation
brh00362  Benzoate degradation
brh00380  Tryptophan metabolism
brh00620  Pyruvate metabolism
brh00630  Glyoxylate and dicarboxylate metabolism
brh00640  Propanoate metabolism
brh00650  Butanoate metabolism
brh00900  Terpenoid backbone biosynthesis
brh01100  Metabolic pathways
brh01110  Biosynthesis of secondary metabolites
brh01120  Microbial metabolism in diverse environments
brh01130  Biosynthesis of antibiotics
brh01200  Carbon metabolism
brh01212  Fatty acid metabolism
brh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:brh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RBRH_03710
   00630 Glyoxylate and dicarboxylate metabolism
    RBRH_03710
   00640 Propanoate metabolism
    RBRH_03710
   00650 Butanoate metabolism
    RBRH_03710
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RBRH_03710
   00072 Synthesis and degradation of ketone bodies
    RBRH_03710
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RBRH_03710
   00310 Lysine degradation
    RBRH_03710
   00380 Tryptophan metabolism
    RBRH_03710
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RBRH_03710
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RBRH_03710
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RBRH_03710
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:brh04147]
    RBRH_03710
Enzymes [BR:brh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RBRH_03710
Exosome [BR:brh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RBRH_03710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CBW74893
UniProt: E5AQL1
Position
1257351..1258532
Genome map
AA seq 393 aa AA seqDB search
MTDVVIVSAVRTAVGKFGGSLARIPAPELGATVIRAALERAGVKPEQVSDVVLGQVLTAG
SGQNPARQALIKAGLPAAVPAMTINKVCGSGLQAVMLAANAVIAGDAQIVVAGGQENMSA
APHVLPRSRDGFRMGDVKLIDSMIVDGLWDVYNQYHMGITAENVAQEYGITREAQDQFAA
LSQNKAEAAQKAGCFDDEIVPIHIPQKQGEPVHFATDEFVRHGVTAESLAGLKPAFSKEG
TVTAANASGINDGAAALVVMSAKKAEALDLKPLARIKSYASAGVDPKVMGMGPVPASRRC
LERAGWSVADLDLMEINEAFAAQALAVHQEMGWDVSKINVNGGAIAIGHPIGASGARILV
TLLHEMRRRDVKRGLASLCIGGGMGVALAVERD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgttgtgatcgtgtccgccgtccgtaccgcggtcggcaaattcggtggctcg
ctggcacgcattcccgcgcctgagcttggcgcaacggtgatccgggctgccctggagcgg
gccggcgtaaagccggagcaggtcagcgacgtggtcctggggcaggtgttgaccgccggc
tccggccaaaatccggcgcgccaagcgctgatcaaggccgggctgcctgctgccgtgccg
gcgatgacgatcaacaaggtctgcggctccggcctgcaggcggtgatgctggccgctaac
gcggtgatcgccggcgacgcgcagatcgtggtcgccggtggccaagagaacatgagcgcc
gcgccgcacgtgctgcccagatcgcgcgacggcttccggatgggggatgtgaagctgatc
gacagcatgatcgtcgacggcttatgggacgtctacaaccagtaccatatgggtatcacc
gccgaaaacgtggcacaggagtacggcattacgcgcgaggcacaggaccagttcgctgcg
ctgtcgcagaacaaggccgaggccgcgcagaaggccggctgcttcgacgacgagatcgtg
ccgatccatatcccgcagaagcagggtgagccggtgcactttgcgaccgacgagtttgtg
cgccacggcgtgacagcagaatcgttggccgggctcaagccggcgttttcaaaggagggc
acggtcaccgcggcgaacgcatcgggcatcaatgacggtgcggcggcgcttgtcgtaatg
tcggcgaagaaagccgaggcactcgacttgaagccgctcgcccgaatcaagtcgtacgcg
agcgcgggagtggacccgaaggtgatgggcatgggcccggtgcccgcctcgcgtcgctgc
ctggagcgcgcgggctggtcggtggccgacttggacctgatggagatcaacgaggcgttt
gccgcgcaagcgctggcggtccatcaggaaatgggctgggacgtgtcgaagatcaatgtg
aatggcggcgcgatcgccatcggtcatccgatcggcgcgtccggtgcgcgtatcttggtc
accctgttgcatgaaatgcgccggcgcgacgtgaagcgcggtctggcgtcgttgtgcatc
ggtggcggcatgggcgtcgcgcttgcggtcgaacgtgactga

DBGET integrated database retrieval system