KEGG   Paraburkholderia rhizoxinica: RBRH_03924Help
Entry
RBRH_03924        CDS       T01355                                 

Definition
(GenBank) Acetyl-coenzyme A synthetase (EC 6.2.1.1)
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
brh  Paraburkholderia rhizoxinica
Pathway
brh00010  Glycolysis / Gluconeogenesis
brh00620  Pyruvate metabolism
brh00640  Propanoate metabolism
brh00680  Methane metabolism
brh01100  Metabolic pathways
brh01110  Biosynthesis of secondary metabolites
brh01120  Microbial metabolism in diverse environments
brh01130  Biosynthesis of antibiotics
brh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:brh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RBRH_03924
   00620 Pyruvate metabolism
    RBRH_03924
   00640 Propanoate metabolism
    RBRH_03924
  Energy metabolism
   00680 Methane metabolism
    RBRH_03924
Enzymes [BR:brh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     RBRH_03924
Lipid biosynthesis proteins [BR:brh01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   RBRH_03924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CBW75394
UniProt: E5AS12
Position
complement(1780121..1782133)
Genome map
AA seq 670 aa AA seqDB search
MFIPLSGGSLMSAIESVLQERRVFFPSAQTTAAAAIAGMDAYRALVAEAERDYDGFWARL
AREHLAWHKPFTKVLDESNAPFYTWFEDGQLNASYNCLDRQIAAGHAQKNAIVFEADDGT
LTPVSYGELHRRVCQFANALKSRGVRKGDRVVIYMPMSVEGVVAMQACARIGATHSVVFG
GFSSKSLNERLIDVGAVALVTADEQMRGGKALPLKRIADEALAMGGCDAVKDVIVYRRTG
GKVAWHEGRDHWLHELVVQQPEQCEPEWVSAEHPLFILYTSGSTGKPKGVQHSTGGYLLW
AMLTMKWAFDIKPDDVFWCTADIGWITGHTYIAYGPLACGATQVVFEGVPTYPNAGRFWE
MIARHKVTVFYTAPTAIRSLIKASDADPACHPRAYDLSSLRIIGTVGEPINPEAWVWYYE
QVGAKRCPVIDTWWQTETGGHMITPLPGATPLVPGSCTLPLPGIMAAIVDETGQDVPNGQ
GGILVIKRPWPSMIRTIWGDPERFKKSYFPEELGGKLYLAGDGSVRDEETAYFTIMGRID
DVLNVSGHRLGTMEIESALVANPIVAEAAVVGRPDDTTGEAVVAFVVLKRARVQGDEAVK
VANELRAWVAKEIGPIAKPKDIRFGDNLPKTRSGKIMRRLLRSLANGEAITQDVSTLENP
AILDQLNEAR
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
ttgtttattccattatcagggggtagtttgatgtctgccattgaatcggtcctgcaagag
cggcgcgtgttttttccgtccgcgcagaccacggccgcggccgccatcgccggcatggat
gcctatcgggcgctggtcgccgaggccgagcgcgactacgacggattctgggctcgcctg
gcgcgcgagcacctggcgtggcacaagccgttcacgaaagtgctggacgaatccaatgca
ccgttctatacgtggttcgaggacggccagctcaacgcttcgtacaattgcctggaccgg
cagatcgccgcgggccacgcgcagaagaacgcaatcgtgtttgaggctgacgatggcacg
ctcacgcctgtctcctacggcgagttgcaccggcgcgtgtgccagtttgccaatgcgctg
aagtcgcgcggcgtgcgcaagggcgatcgcgtggtgatttacatgccgatgtcggtcgaa
ggcgtcgtcgcgatgcaggcctgtgcccggatcggcgcaacgcattcggtcgtgtttggc
gggttttcgtcgaaatcgctcaatgagcggctgatcgatgtcggcgctgtggcgctggtc
actgccgacgagcagatgcgcggcggcaaggcgctgccgcttaagcgtattgccgacgaa
gccctggcgatgggcggatgcgacgcggtgaaggatgtcatcgtctatcggcgcaccggc
ggcaaggtcgcctggcacgaagggcgcgaccattggctgcatgaactggtggtccaacag
cccgagcaatgcgagccggaatgggtcagtgctgaacatccgctgtttattctgtacacg
tcgggttccaccggcaaaccgaagggcgtgcagcacagcaccggcggctatctgctgtgg
gccatgttgacaatgaaatgggcgttcgatatcaagccggacgatgtgttctggtgtacc
gccgacatcggctggatcaccggccatacgtatatcgcgtacgggccgctggcgtgtggt
gcaacgcaagttgtgttcgaaggcgtgccgacgtatccgaacgcgggccgcttctgggag
atgatcgcgcggcacaaggtcaccgtgttctatacggcgccgaccgcgatccgctcgctg
atcaaggcatcggatgccgatccggcatgccatccgcgcgcgtacgacctgtcgtcgctg
cgtatcatcggcactgtcggcgagccgatcaaccccgaagcgtgggtctggtattacgag
caggtcggcgccaagcgttgcccggtcatcgacacgtggtggcagaccgagaccggcggc
catatgatcacgccgctgcccggcgccacgccgctcgtgccgggctcatgcacgctgccg
ttgccgggcatcatggcggcaatcgtcgacgagaccggccaggacgtaccgaacggacag
ggcgggatcctcgtgatcaagcgcccgtggccttcgatgatccgcacgatctggggcgat
ccggagcgtttcaagaaaagctattttcccgaggaactcggtggcaagttgtatcttgcc
ggagacggcagcgtacgggacgaggaaaccgcgtatttcacgatcatgggacgcatcgac
gatgtgctgaatgtgtccggtcaccggctcggcacgatggagatcgagtcggcgctggtg
gctaatccgatcgtcgccgaagcggcggtcgtcggccggcccgatgacacaaccggcgaa
gcggtggtcgcgtttgtcgtactcaagcgcgcacgtgtgcagggcgacgaggccgtgaag
gtggcaaatgagttgcgggcgtgggtcgcgaaggaaatcggtccgattgctaagccgaag
gatattcgattcggcgacaacttgccgaagacgcgctccggcaagatcatgcggcggctg
ctgcgctcgctggccaacggcgaggcgatcacgcaagatgtgtcgacactggaaaacccg
gctatcctcgatcagttgaacgaggcgcgctga

DBGET integrated database retrieval system