KEGG   Brevibacterium sp. CS2: FDF13_01575Help
Entry
FDF13_01575       CDS       T05958                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
bri  Brevibacterium sp. CS2
Pathway
bri00250  Alanine, aspartate and glutamate metabolism
bri00330  Arginine and proline metabolism
bri01100  Metabolic pathways
bri01110  Biosynthesis of secondary metabolites
bri01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bri00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FDF13_01575
   00330 Arginine and proline metabolism
    FDF13_01575
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bri03000]
    FDF13_01575
Enzymes [BR:bri01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     FDF13_01575
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     FDF13_01575
Transcription factors [BR:bri03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    FDF13_01575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh
Motif
Other DBs
NCBI-ProteinID: QCP04157
Position
349865..353422
Genome map
AA seq 1185 aa AA seqDB search
MLSTPGTMPALTDAGLAPLTDSAVARVRRWLRISAGTPAAKDAAADRLAAVLSDPNGLDF
TVGFVDRVVGTDDVHAAADALVDVARLTPDTMSALDRAQVKAGAALAPVLPQVVVPAARA
RLRSMVGHMVIDSRDKQFGKAVAELTADGHRLNINLLGEAVLGEEEADKHLAETRRLLQR
SDVDYVSVKVSSVASQVSMWAFDETVDYVVERLLPLYREAAASPAGSRFVNLDMEEYKDL
ELTLAVFMRILDDPELAHLEAGIVLQAYLPDALGAMQRLSEYASARVAAGGAGIKVRLVK
GANLAMERVHAEVAGWELTTCPSKQATDANYKRVLHWLFTPERMAGVRIGVAGHNLFDIA
FAHELSLARGVTDRVEFEMLQGMAAEQAAAVSADVGDLLLYVPAVHPQEFDVAISYLVRR
LEENSANENFMSGIFELRNGNAVFRREEDRFRASVDDLAAVLAAEGETAPLPTRRQDRGA
EAEQGAAYTSGAELGGFANEPDTDPSLPANQRWARALLEQSSAPGWLDTRPAPESLDSVE
EVDDRVASGREAALAWRELGARARGEILLRAADVFAARRGEFLATMAAEAGKTLDQSDPE
ISEAIDFIRYYADRALELEAVEGAEFTPDALVLITPPWNFPVAIPTGSTVAALAVGAAVI
HKPSSPTPHCSALLVECLWEAGVPREVLQLVAPTEGEVGKALVAHPGVDRVILTGASETA
ALFRGFNPELDINAETSGKNALIVTPAADRDLAMADLVHSAFGHAGQKCSAASLAIMVGS
TYDSERYRRQLVDAASSLIVDVPANLRATMGPLTEEPSDKLLRALTTLEPGESWVLEPRR
LDDSGRLWSPGIKDGVKPGSFFHLTECFGPVLGLMRADTLAEAMELQNQVDFGLTAGIHS
LDAAEVATWLDTVQAGNVYVNRGITGAIVQRQPFGGWKKSSVGLGSKAGGPNYLMLFGDW
SDGSVRDEAWLDAARASDRRAWEQEFGCASDPTGLTAEANIFRYLPRAVTVRVTAAALAI
EVTRTAHAAQLAQTPVTWSVSPDAAAEVRAAVEDAARGAGQPAGSDGPAGASGTAGSTGA
VSTGEGGVAIESAADFAARVESGAYDDGVGARVRMIGAVEPELTGAIAQRPEVAVVDDAV
TGSGRVELRYFVQEQAVSMTLHRFGNPSRSFHALAESLCPDRRAR
NT seq 3558 nt NT seq  +upstreamnt  +downstreamnt
atgctcagcaccccagggaccatgccagcactcaccgacgccggactggcgcccctcacc
gactccgcagtggcgcgggtgcgccgctggctgcggatctccgccggcacccccgcggcc
aaggacgccgccgcggaccggctcgccgcagtcctctccgatcccaatggcctcgacttc
accgtcggcttcgtcgaccgggtcgtcggcaccgatgacgtccacgccgccgcggacgcg
ctcgtcgacgtcgcccgcctgaccccggacaccatgtccgcgctcgaccgcgcacaggtc
aaggccggtgccgcgctcgccccggtgctgccgcaggtcgtcgtacccgccgcccgtgcg
cggctgcgctcgatggtcggccacatggtcatcgactcccgcgacaagcagttcgggaag
gccgtcgcggagctcaccgccgacgggcaccggctcaacatcaacctgctcggggaggcc
gtgctcggcgaggaggaggcggacaagcacctcgccgagacccgccgcctgctccagcgg
tccgatgtcgactacgtgtccgtcaaggtctcctcggtcgcctcgcaggtgtcgatgtgg
gcgttcgacgagaccgtcgactacgtcgtcgagcggctcctgccgctctaccgcgaggcc
gccgcctccccggccggcagcagattcgtcaatctcgacatggaggagtacaaggacctc
gagctcacgctcgccgtgttcatgcgcatcctcgacgacccggagctcgcgcacctcgag
gccgggatcgtgctccaggcctacctgcccgacgcgctcggcgcgatgcagcggctgagc
gagtacgcgagcgcccgggtggccgccggcggggccgggatcaaggtgcgcctggtcaag
ggcgccaacctcgcgatggagcgcgtgcacgccgaggtcgccggctgggagctcaccacc
tgtccgtccaagcaggccaccgacgcgaactacaagcgcgtcctccactggctgttcacg
cccgagcggatggccggggtgcggatcggcgtcgccggccacaacctcttcgacatcgcc
ttcgcccacgagctctcgctcgcccgcggggtcaccgaccgggtcgagttcgagatgctc
cagggcatggccgcggagcaggccgccgcggtgagcgccgacgtcggcgatctcctcctc
tacgtcccggcggtgcacccgcaggagttcgacgtcgcgatctcctacctcgtccgccgg
ctcgaggagaactcggcgaacgagaacttcatgtccgggatcttcgagctccgcaacggc
aacgccgtgttccggcgcgaggaggaccgcttccgcgcctcggtcgacgacctcgccgcc
gtcctcgcggccgagggcgagaccgctcccctgcccacccgccgccaggaccgcggtgcc
gaggcggagcagggtgcggcgtacacctcgggcgcggagctcggcgggttcgccaacgag
cccgacaccgacccctcgctgccggcgaaccagcgctgggcacgggcgctcctcgagcag
tcgtccgcaccgggctggctcgacacccgccccgccccggaatccctggactccgtcgag
gaggtcgacgaccgcgtcgcctccggccgcgaggccgcactcgcctggcgcgagctcggt
gcccgcgcccgcggggagatcctgctccgcgccgcggacgtgttcgccgcccgtcgcggg
gagttcctcgcgacgatggccgccgaggccgggaagacgctcgaccagtccgatccggag
atctccgaggcgatcgacttcatccgctactacgcggatcgcgccctcgagctcgaggcg
gtggagggcgccgagttcactccggacgcgctcgtcctcatcaccccgccgtggaacttc
cccgtcgcgatccccaccgggtcgacggtcgccgcgctcgccgtcggcgccgcggtcatc
cacaagccctcgagccccaccccgcactgctcggcgctgctcgtcgagtgtctgtgggag
gccggcgtcccgcgcgaggtgctccagctcgtcgccccgaccgagggcgaggtcggcaag
gcgctcgtcgcgcaccccggcgtcgaccgggtcatcctcaccggcgcctcggagaccgcg
gccctgttccggggcttcaacccggagctcgacatcaatgcggagacctcgggcaagaac
gcgctcatcgtcaccccggcggcggaccgcgacctcgcgatggccgacctcgtccactcc
gcgttcggccacgccgggcagaagtgctcggcggcctcgctggcgatcatggtcggctcg
acctacgactccgagcgctaccgccgccagctcgtcgatgcggcgtcctcgctcatcgtc
gacgtgcccgcgaacctccgggcgaccatgggcccgctcaccgaggagccctcggacaag
ctgctccgcgcgctcaccaccctggagcccggggagagctgggtgctcgagccgcgccgg
ctcgacgactccggccgcctgtggtcgccgggcatcaaggacggcgtgaagccgggctcg
ttcttccacctcaccgagtgcttcggaccggtgctcggcctcatgcgtgcggacacgctg
gccgaggcgatggagctgcagaaccaggtcgacttcggcctcaccgccggcatccactcg
ctcgacgccgccgaggtcgcgacctggctcgacaccgtgcaggccggaaacgtctacgtc
aaccgcggcatcaccggcgcgatcgtccagcgtcagccgttcggcggctggaagaagtcc
tcggtgggcctgggatccaaggccggcggcccgaactacctcatgctgttcggggactgg
tcggacggctcggtgcgcgacgaggcctggctcgacgccgcccgcgcgagcgatcggcgg
gcgtgggagcaggagttcggctgcgcctccgaccccaccggcctcaccgccgaggcgaac
atcttccgctacctgccgcgcgccgtcaccgtgcgcgtcaccgccgccgcactggccatc
gaggtcacccgcaccgcgcacgccgcgcagctcgcccagacccccgtcacctggtcggtg
tcccccgacgccgccgctgaggtgcgcgccgcggtcgaggacgccgcccggggtgccggg
cagccggcagggtctgacgggccggcgggcgcctcgggcacggccgggtccaccggtgcg
gtttccaccggcgagggtggcgtcgcgatcgagtcggcggccgacttcgccgcgcgcgtg
gaatccggcgcttacgacgacggggtgggcgcacgggtgcggatgatcggcgcggtcgag
cccgaactcaccggcgcgatcgcgcagcgcccggaggtcgcggtcgtcgacgatgccgtg
accggctccggccgcgtcgagctccgctacttcgtgcaggagcaggccgtgtcgatgacg
ctccaccggttcggcaacccgagccgcagcttccacgcgctcgcggagtcgctctgcccc
gaccgccgcgcccgctga

DBGET integrated database retrieval system