KEGG   Brevibacterium sp. CS2: FDF13_04115Help
Entry
FDF13_04115       CDS       T05958                                 

Definition
(GenBank) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
bri  Brevibacterium sp. CS2
Pathway
bri00430  Taurine and hypotaurine metabolism
bri00460  Cyanoamino acid metabolism
bri00480  Glutathione metabolism
bri01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bri00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    FDF13_04115
   00460 Cyanoamino acid metabolism
    FDF13_04115
   00480 Glutathione metabolism
    FDF13_04115
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bri01002]
    FDF13_04115
Enzymes [BR:bri01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     FDF13_04115
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     FDF13_04115
Peptidases and inhibitors [BR:bri01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   FDF13_04115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: QCP04571
UniProt: A0A4V1EBM2
Position
complement(945222..946865)
Genome map
AA seq 547 aa AA seqDB search
MLTPTPRARRFRSMITTPQPEATDAGVEVLAAGGNAVDAAIAAAMVQGVVDPLMCGIGGM
ADMQIVTPDGTRHIIDGLGTSPAGVRPDMWEADLLGPTTDGFGYRVAGFVNETGAQSVMT
PGTLRAFGRLHARFGSLPWADLFAAAIRLAREGWLVRPHTYTVLTQNERRYGRMNMGEKL
AITPDGRRIYLGEGGSFPSVGDTIINPELADTLIHLRDHGAEALYTGELAVSVADSVAAD
GGFLTAADLADYELHEPAPLSASYRGLTVSAAPAPAGGVQLLQTLGIMDRFDLSALEHNS
PEHIRILAEAMKTSLRDKERLWNEADASPEDFAALLTADSLDAAARAVRSGEKADVDAAR
PQVSTHESRHTTHLCAADESGLTISLTHTLGNPSGYIPAGTGFVLNGGMSTFDPRPGHVN
SIQPGKRRNTTMAPVVVMSGDEPVVAIGAPGASWITPAVAQGISNILDFGMNAQEAVMAP
RVVATSNAIDISNRIPRRVQTAVEDMGYEVRRSALSYAFAGVHALTRFEGTLAGGADPQR
DGYASGV
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgctgacccccacacctcgcgcccgccgcttccgctcgatgatcaccaccccgcagccc
gaggctaccgacgccggggtcgaggtgctcgccgcgggcggcaacgccgtggacgccgcg
atcgccgcggccatggtccagggcgtcgtcgacccgctcatgtgcgggatcggcgggatg
gccgacatgcagatcgtcaccccggacggcacccgccacatcatcgacggcctcggcacg
agtccggccggggtgcgcccggacatgtgggaggccgacctgctgggtcccaccacggac
ggcttcggctaccgggtggcgggcttcgtcaacgagaccggcgcccaatcggtgatgacg
ccgggcaccctgcgcgccttcggccgcctccacgcacggttcggctcgctgccgtgggcc
gatctcttcgccgcggcgatccggctggcccgcgagggatggctcgtccgcccccacacg
tacaccgtgctcacccagaacgagcgccgctacgggcggatgaacatgggcgagaagctc
gcgatcacgcctgatggccgccgcatctatctgggcgagggcggcagcttcccgagcgtc
ggcgacacgatcatcaacccggagctcgccgacaccctcatccacctccgcgatcacggc
gcggaggcgctgtacaccggtgagctcgccgtctcggtcgccgattcggtggccgccgac
ggcggattcctcaccgccgcggacctcgccgactacgagctccacgagcccgcaccgctc
tccgcgagctaccggggcctcaccgtctccgccgccccggcaccagccggcggggtccag
ctgctccagacgctgggcatcatggaccggttcgacctctccgcactcgagcacaacagc
cccgagcacatccggatcctcgccgaggcgatgaagacctcgctgcgggacaaggagcgg
ctgtggaacgaggccgatgcctcaccggaggacttcgcggccctcctcaccgccgactcc
ctcgacgcggcggcccgggccgtgcgctccggggagaaggccgacgtcgacgccgcccgg
ccccaggtctccacccacgaatcccggcacaccacgcacctctgcgcggccgacgagtcg
gggctgacgatctccctcacccacacgctcggcaacccgtcgggctacatcccggcgggc
accggtttcgtgctcaacggcggcatgagcaccttcgatccgcggccgggccacgtgaac
tcgatccagccgggcaagcgccgcaacacgacgatggccccggtcgtcgtcatgtccggc
gatgagccggtggtggcgatcggcgcaccgggcgcttcgtggatcaccccggcggtggcc
caggggatctcgaacatcctcgacttcgggatgaacgcgcaggaggcggtcatggcaccg
cgcgtggtcgccacctcgaacgcgatcgacatctccaaccggatcccgcggcgcgtgcag
accgcggtggaggacatgggctacgaggtgcggcgctcagcgctgtcctacgccttcgcc
ggcgtgcatgcactcacccggttcgaggggacgctggccggcggcgccgacccgcagcgc
gacgggtacgcctcgggcgtgtga

DBGET integrated database retrieval system