KEGG   Bradyrhizobium sp. SK17: CWS35_00735Help
Entry
CWS35_00735       CDS       T05325                                 

Definition
(GenBank) betaine-aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
brk  Bradyrhizobium sp. SK17
Pathway
brk00010  Glycolysis / Gluconeogenesis
brk00053  Ascorbate and aldarate metabolism
brk00071  Fatty acid degradation
brk00280  Valine, leucine and isoleucine degradation
brk00310  Lysine degradation
brk00330  Arginine and proline metabolism
brk00340  Histidine metabolism
brk00380  Tryptophan metabolism
brk00410  beta-Alanine metabolism
brk00561  Glycerolipid metabolism
brk00620  Pyruvate metabolism
brk00625  Chloroalkane and chloroalkene degradation
brk00903  Limonene and pinene degradation
brk01100  Metabolic pathways
brk01110  Biosynthesis of secondary metabolites
brk01120  Microbial metabolism in diverse environments
brk01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:brk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CWS35_00735
   00053 Ascorbate and aldarate metabolism
    CWS35_00735
   00620 Pyruvate metabolism
    CWS35_00735
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CWS35_00735
   00561 Glycerolipid metabolism
    CWS35_00735
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CWS35_00735
   00310 Lysine degradation
    CWS35_00735
   00330 Arginine and proline metabolism
    CWS35_00735
   00340 Histidine metabolism
    CWS35_00735
   00380 Tryptophan metabolism
    CWS35_00735
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CWS35_00735
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CWS35_00735
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CWS35_00735
Enzymes [BR:brk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     CWS35_00735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AUC93033
UniProt: A0A2K8Y6D0
Position
complement(150233..151729)
Genome map
AA seq 498 aa AA seqDB search
MAVSQAVPISRHPYADGSYKKMLIDGKWLDAASGKIFETHNPATGELLATVAEGDAEDIN
RAVAAARRAFEGPWSKVKPFERQNMLLKLAELVEANFEELSQLDTLDMGAPISRTRGNRL
RALGMLRYYAGQATAIHGETIENSLPGEIFSYTLKEPIGVVGAIIPWNGPLTASIWKIGP
AIATGCTVVLKPAEESPLTSLRIGELCMEAGIPPGVVNVVPGYGETAGAALANHPDVDKV
AFTGSHITGQSIIRASAGNLKRVSLELGGKSPDIVFADADLDAAVPGAAMAVFANSGQIC
SAGTRLFVEQKVYDEFVGRVAEFGKKLQVGNGLDPNTQIGPLVSKDQLDRVSGYLDIGAK
EGAKAVVGGGRLTEGALSKGYFVQPTVFANVQDNMRIAQEEIFGPVISAISFKDPDELIK
RANATTFGLGSGVWTTNVSKAHQVAKALRAGSVWVNCYQAMDPAVPFGGYKMSGYGRESG
KQHVEEYLNVKAVWIKTG
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggctgtttcgcaggctgttccgatctcgcgccatccttatgccgacggctcctacaag
aagatgctgatcgacggcaaatggctcgacgccgcctccggcaagatattcgaaacccac
aaccccgccactggtgaactgctcgcgaccgtcgccgagggcgacgccgaggacatcaac
cgcgcggtcgcggcggcacgtcgtgcgttcgagggaccgtggagcaaggtgaagccgttc
gagcggcagaacatgctgctcaagctcgccgagctggtcgaggccaatttcgaggaattg
tcccagctcgacacgctcgacatgggcgcgccgatcagccgcacccgcggcaacaggctg
cgcgcgctcggcatgctgcgctattacgcaggacaggcgaccgcgatccatggcgagacc
atcgagaactcgctgcccggcgagatattctcctacacgctgaaggagccgatcggcgtg
gtcggcgccatcatcccgtggaacgggccgctgaccgcctcgatctggaagatcggcccg
gcgatcgcgaccggctgcaccgtggtgctgaagccggccgaggaatcgccgctgacctcg
ctgcgcatcggcgagctctgcatggaagccggcattccgcccggcgtggtcaacgtcgta
cccggctatggcgagaccgcgggcgcagcacttgccaatcatcccgatgtcgacaaggtc
gcgttcaccggctcgcacatcacgggacagtcgatcatccgtgcctccgccggcaacctc
aagcgcgtctcgctcgagctcggcggcaagtcgccggacatcgtgttcgccgatgccgat
ctcgatgccgcggtgccgggtgcggcgatggcggtgttcgccaattccggccagatttgc
agcgccggcacccggctgttcgtcgagcagaaggtctatgacgaattcgtcggccgcgtc
gccgagttcggcaagaagcttcaggtcggcaacggcctcgaccccaacacccagatcggc
ccgctggtgtcgaaggatcagctcgatcgcgtctccggctatctcgacatcggcgcaaag
gaaggcgccaaggccgtggtcggcggcggccgcctcaccgaaggcgcgctgtcgaagggc
tatttcgtgcagccgacggtgttcgccaatgtgcaggacaacatgcgcatcgcccaggag
gagatcttcggcccggtgatctcggcgatctcgttcaaggatccggacgaactgatcaag
cgcgccaatgccaccaccttcggcctcggctccggggtctggaccaccaatgtcagcaag
gcgcaccaggtcgcaaaagcgctgcgcgccggctcggtctgggtcaattgctaccaggcg
atggaccccgcggtgccgttcggcggctacaagatgagcggctacggccgcgaatccggc
aagcagcacgtcgaggagtatctcaacgtcaaggcggtctggatcaagacgggctag

DBGET integrated database retrieval system