KEGG   Bradyrhizobium sp. SK17: CWS35_04320Help
Entry
CWS35_04320       CDS       T05325                                 

Definition
(GenBank) amidohydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
brk  Bradyrhizobium sp. SK17
Brite
KEGG Orthology (KO) [BR:brk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CWS35_04320
Enzymes [BR:brk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     CWS35_04320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AUC93623
UniProt: A0A2K8Y848
Position
933436..934314
Genome map
AA seq 292 aa AA seqDB search
MSTENKFTAAMVQMRTGLLPEPSLEQGTKLIREAAAQGAKYVLTPEVSNMMQLNRKALFE
HLAGEEDDKSLKAYRALAAELKIHLHIGSLALRYSPEKAVNRSFLIGPEGNVLASYDKIH
MFDIDLPGGESYRESANYQPGETAVISDLPWGRIGLTICYDVRFPALYRALAEAGASFLT
VPSAFTRKTGEAHWHTLLRARAIETGCFVFAAAQAGLHENKRETFGHSLIVDPWGEILAE
GGVEPGVFLAEIDPAKVETARKTIPSLQHGRRFGIADPKAGPEHLHLVRGSA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggagaacaagttcaccgcggcgatggtgcagatgcgcaccggattgctgccg
gagccgagcctcgagcagggcacgaagctgatccgcgaggcggcggcgcagggcgccaaa
tacgtgctgacgcctgaagtcagcaacatgatgcagttgaaccgcaaggcgctgttcgag
cacctggcgggcgaagaggacgacaagtcgctcaaggcctatcgcgcgctggccgcggaa
ctgaagatccacctgcatatcgggtcgctggcgctgcgctattcgccggagaaggcggtc
aaccgctcgttcctgatcgggcccgagggcaacgtgctcgcgagctacgacaagatccac
atgttcgacatcgacctgcccggcggcgaaagctatcgcgaatcggccaattaccagccc
ggcgagaccgccgtgatctccgacctgccctggggccggatcggcttgacgatctgctac
gacgtgcgcttcccggcgctgtatcgcgcactggccgaggcgggagcttccttcctcacc
gttccctcagccttcacccgcaagaccggcgaagcgcactggcacactttgctgcgcgcc
cgcgccatcgagaccggctgcttcgtgttcgccgcggcccaggccggcctgcacgagaac
aagcgcgagaccttcgggcactcgctgatcgtcgacccctggggcgagatcctcgccgag
ggtggcgtcgagccgggcgtgttcctggccgagatcgatcccgccaaggtcgaaaccgcg
cgcaagaccatcccctcgcttcagcacgggcggcgatttggcatcgccgaccccaaggcc
ggcccggagcatctgcacctcgtccggggctcggcatga

DBGET integrated database retrieval system