KEGG   Bradyrhizobium sp. SK17: CWS35_05525Help
Entry
CWS35_05525       CDS       T05325                                 

Gene name
coaBC
Definition
(GenBank) bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
brk  Bradyrhizobium sp. SK17
Pathway
brk00770  Pantothenate and CoA biosynthesis
brk01100  Metabolic pathways
Module
brk_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:brk00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    CWS35_05525 (coaBC)
Enzymes [BR:brk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     CWS35_05525 (coaBC)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     CWS35_05525 (coaBC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein YjeF_N
Motif
Other DBs
NCBI-ProteinID: AUC93816
UniProt: A0A2K8Y828
Position
1197737..1199161
Genome map
AA seq 474 aa AA seqDB search
MASLTIRKLDDTLKAYLRLRSAKNGRSVEEEVRVILRELADGGTEPTEAPPAGSLTVAAP
APRVASAAGEPRVTLIIGGGIAAYKALDLIRRLKERHVRVRCVLTKAAQQFVTPLAASAL
SHERVYTDLFDAESEFDAGHIRLARDCDLIVVAPATADLMAKMAQGHADDLATATLLAAN
RPILLAPAMNPLMWNNPATRRNLLQLRRDGVHTVGPNAGEMAEAGEAGVGRMAEPVEIAA
AADRMLRPPQPRPLAGKRVLITAGPTHEAIDPVRYIANRSSGKQGFAIAAAARAAGAEVV
LVTGPVELDDPQGIAVMRVESARDMLHRVEAALPVDVAIFAAAVADWRVATEGSQKLKKT
AAGMPPLQLVENPDILATISKLKDKRPPLVIGFAAETEHLIENAKAKFARKGCDWIVAND
VSPATGVMGGDRNTVHLLSREGKEVTVDSWPVMTKEEVATALVSRIAREVGTTS
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggccagcctgaccatccgcaaactcgacgacacgctgaaggcctatctgcggctgcgc
tccgccaagaacgggcgctcggtcgaggaggaggtccgggtcatccttcgcgagctcgcc
gacggcggtacggagcccaccgaggcgccgcccgccggttccctgacggttgcagccccc
gccccacgggtcgccagcgcggctggcgagccccgggtgaccctgatcattggcggcgga
atcgcggcctacaaggcgctggacctgatccggcggctcaaggaacggcacgtccgggtc
cgctgcgtgctgaccaaggcggcccagcaattcgtcaccccgctggccgccagcgcgctg
tcgcatgagcgggtctacaccgacctgttcgacgccgagagcgagttcgacgccggccat
atccggctggcgcgggactgcgacctgatcgtggtggcgccggcgaccgccgacctgatg
gccaagatggcgcagggccatgccgacgacctcgccaccgcgacgctgctggcggccaac
cggccgatcctgctggcgccggcgatgaacccgctgatgtggaacaaccccgccacccgc
cgcaatttgctgcaactccgccgcgacggcgtccacaccgtcggccccaatgccggcgag
atggcggaggccggcgaagccggggtcggacggatggccgagcctgtcgagatcgctgcc
gccgccgaccgcatgttgcggccgccgcagccgcgcccgctcgccggcaagcgcgtgctg
atcaccgccggcccgacccatgaggcgatcgacccggtccgctacatcgccaaccgctca
tccggcaagcagggctttgcgattgccgccgcggcgcgcgcggccggcgccgaggtcgtg
ctggtgaccggtccggtcgagctcgacgacccgcagggtatcgccgtgatgcgcgtcgag
tccgcgcgcgacatgctgcaccgggtcgaagccgcgctgccggtcgacgtcgcgatcttc
gcggctgcggtcgccgactggcgggtcgccactgaaggcagtcagaaattgaagaagacc
gcggccggcatgccgccgctgcaactggtcgagaaccccgacatcctcgcgacaatctcc
aagctgaaggacaagcggccgccgctggtgatcggcttcgccgccgagaccgagcacctg
atcgagaacgccaaggccaagttcgcgcgcaagggctgcgactggatcgtcgccaacgac
gtgtcgccggcgaccggcgtgatgggcggcgaccgcaacaccgtccacctgctctcgcgc
gagggcaaggaggtcaccgtcgactcctggccggtcatgaccaaggaagaagtcgcgact
gcgctggtgtcgcggatcgcaagagaagtgggaaccacatcgtga

DBGET integrated database retrieval system