KEGG   Bradyrhizobium sp. SK17: CWS35_24445Help
Entry
CWS35_24445       CDS       T05325                                 

Definition
(GenBank) amino acid ABC transporter
  KO
K01713  cyclohexadienyl dehydratase [EC:4.2.1.51 4.2.1.91]
Organism
brk  Bradyrhizobium sp. SK17
Pathway
brk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
brk01100  Metabolic pathways
brk01110  Biosynthesis of secondary metabolites
brk01130  Biosynthesis of antibiotics
brk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:brk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CWS35_24445
Enzymes [BR:brk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     CWS35_24445
    4.2.1.91  arogenate dehydratase
     CWS35_24445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd Phosphonate-bd SBP_bac_5
Motif
Other DBs
NCBI-ProteinID: AUC97043
UniProt: A0A2K8YHW3
Position
complement(5305965..5306738)
Genome map
AA seq 257 aa AA seqDB search
MLRALAGLALAFLLSAAHAQQAPSRLDEIVKRGTLRVGMTGDYLPFTSLDKETKAFRGFD
VDMAQSLGKALGVKVEFVPTSWPQMMKDFEADNFDIAMGGISITFDRQKKGLFSTPIMRE
GKTPIARCADQGKYDTLAEIDRPGTRVIVNPGGTNERFARANVKAADIRVFGDNTKIFDE
IAKGDADLMMTDASETRYQQKLHPGVLCAVHPDKPFDFAEKAYWMQRDVALKAFVDQWLH
IAREDGSYAKIYAAWFE
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgcgcgctggccggcctcgctctcgcatttctgctatccgccgcgcatgcgcag
caggccccgtcgcggctcgacgagatcgtcaagcgcggcacgctgcgcgtcggcatgacc
ggcgactacctgcccttcacttccctcgacaaggagaccaaggccttccgcggcttcgat
gtcgacatggcgcagtcgctcggcaaggcgctcggcgtcaaggtcgaattcgtcccgacc
tcctggccgcagatgatgaaggatttcgaggccgacaatttcgacatcgcgatgggcggc
atctcgatcaccttcgaccggcagaagaagggcttgttctcgacgccgatcatgcgcgag
ggcaagacgccgatcgcgcgttgcgccgaccagggcaagtacgacacgctcgccgagatc
gacaggcccggcacccgcgtcatcgtcaatcccggcggcaccaacgagcggtttgcccgc
gccaacgtgaaggcggccgatatccgcgtcttcggcgacaacaccaaaatcttcgacgag
atcgccaagggcgacgccgacctgatgatgaccgacgcatccgagacgcgctatcagcag
aagctgcatcccggcgtgctgtgcgccgtgcatcccgacaagccgttcgacttcgcggaa
aaggcctactggatgcagcgagacgtcgccctgaaggcgttcgtcgaccagtggctccac
atcgcgcgcgaggatggcagctacgcgaagatctacgctgcgtggttcgaatag

DBGET integrated database retrieval system