KEGG   Bradyrhizobium sp. SK17: CWS35_28375Help
Entry
CWS35_28375       CDS       T05325                                 

Definition
(GenBank) phosphatidylserine decarboxylase family protein
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
brk  Bradyrhizobium sp. SK17
Pathway
brk00564  Glycerophospholipid metabolism
brk01100  Metabolic pathways
brk01110  Biosynthesis of secondary metabolites
Module
brk_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:brk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CWS35_28375
Enzymes [BR:brk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     CWS35_28375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase PsbT FGF
Motif
Other DBs
NCBI-ProteinID: AUC97728
UniProt: A0A2K8YJB5
Position
complement(6123526..6124224)
Genome map
AA seq 232 aa AA seqDB search
MSIANSIRAQIPPIHPEGYPFIGGFALASLILFWIWTPLGWIGTLLTVWCALFFRDPVRV
TPLRDGILVSPADGRVSMVVQALPPAELGLGDQPLPRISVFMSVFNCHVNRSPVAGRIDR
IAYRPGAFINAELDKASEDNERNSLVISTANGRIGVVQIAGLVARRIVCFVKEGQSIGAG
ERFGLIRFGSRLDVYLPDGTKALVSEGQTAVAGETILADFRNADPGRTYRAD
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatcgccaattccatccgcgcgcagatcccgccgatccacccggaggggtatccc
ttcatcggtggtttcgcgctggcgagcctgatcctgttctggatctggaccccgctgggg
tggatcggaacgctgctcacggtctggtgcgcattgttcttccgcgatccggtgcgcgtg
acgccgctgcgcgacggcatcctggtgtcgccggccgatggccgggtctccatggtggtg
caggcgctgccgccggccgaactcggtcttggcgaccagccgctgccgcgcatctcggtg
ttcatgagcgtgttcaactgccatgtgaaccgcagcccggtggccggccgcatcgaccgc
atcgcctatcgccccggtgctttcatcaatgccgagctcgacaaggcgagcgaggacaat
gaacgcaattcgctggtcatctcgactgccaacggccgcatcggtgtggtccagatcgca
ggcctggtggcgcgccgcatcgtctgcttcgtcaaggaagggcagtcgatcggcgccggc
gagcgcttcggcctgatccggttcggctcgcggctcgacgtctacctccccgatggcacc
aaggcgctggtttccgaaggccagaccgcggtcgccggcgagaccatcctggcggatttc
cgcaacgccgatcccggccgcacctatcgcgccgattaa

DBGET integrated database retrieval system