KEGG   Bradyrhizobium sp. SK17: CWS35_30775Help
Entry
CWS35_30775       CDS       T05325                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
brk  Bradyrhizobium sp. SK17
Pathway
brk00020  Citrate cycle (TCA cycle)
brk00480  Glutathione metabolism
brk01100  Metabolic pathways
brk01110  Biosynthesis of secondary metabolites
brk01120  Microbial metabolism in diverse environments
brk01130  Biosynthesis of antibiotics
brk01200  Carbon metabolism
brk01210  2-Oxocarboxylic acid metabolism
brk01230  Biosynthesis of amino acids
Module
brk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
brk_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:brk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CWS35_30775
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CWS35_30775
Enzymes [BR:brk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CWS35_30775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AUC98140
UniProt: A0A2K8YKK7
Position
6637683..6638897
Genome map
AA seq 404 aa AA seqDB search
MAKIKVSNPVVELDGDEMTRIIWQYIKDKLINPFLDVELLYFDLGMEYRDETNDQVTIDA
AEAIKKVGVGVKCATITPDEARVKEFGLKQMWKSPNGTIRNILGGVIFREPIICKNVPRL
VPGWTKPIIIGRHAYGDQYRATDIKFPGKGTLSLKFVGEDGTVIEREVFKAPGAGVAMEM
YNLDDSIIDFARASLNYGLLRNYPVYLSTKNTILKVYDGRFKDIFQDVYDREFKKEFEAK
GLTYEHRLIDDMVASALKWSGGYVWACKNYDGDVQSDTVAQGYGSLGLMTSVLLTPDGKT
VEAEAAHGTVTRHYREHQKGKETSTNSIASIFAWTRGLAHRAKLDNNPELAKFATTLEKV
CVSTVEEGYMTKDLALLVGADQRWLSTTGFLDKVSDNLVKAMAG
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaatcaaggtatccaatcccgtcgtcgagctcgatggcgacgagatgacccgg
atcatctggcagtacatcaaggacaagctgatcaacccgttcctggatgtcgaactgctc
tacttcgatctgggcatggaataccgcgatgagaccaacgaccaggtcaccatcgacgcc
gccgaagccatcaagaaggtcggcgtcggcgtcaaatgcgccaccatcacccccgacgag
gcccgggtgaaggagttcggcctgaagcagatgtggaagtcgccgaacggcaccatccgc
aacatcctcggcggcgtgatcttccgcgagccgatcatctgcaagaacgtgccgcgcctg
gttcccggctggaccaagccgatcatcatcggccgccacgcctatggcgaccagtaccgc
gccaccgacatcaagttcccgggcaagggcacgctgtcgctgaagttcgtcggcgaggac
ggcaccgtgatcgagcgcgaagtgttcaaggcgcccggcgccggcgtcgcgatggagatg
tacaatctcgacgactccatcatcgatttcgcccgcgcttcgctgaactacggcctgctg
cgcaactacccggtctatctctcgaccaagaacaccatcctcaaggtctatgacggccgc
ttcaaggacatcttccaggacgtctacgaccgcgaattcaagaaggaattcgaggccaag
ggcctgacctacgagcaccgcctgatcgacgacatggtcgcctcggcgttgaaatggtcc
ggcggctatgtctgggcgtgcaagaactacgacggcgacgtgcagtccgacactgtggcc
cagggctacggctcgctcggcctgatgacctcggtgctgctcaccccggacggcaagacg
gtggaagccgaagccgcgcacggcacggtgacccggcactaccgcgagcaccagaagggc
aaggagacctcgaccaactcgatcgcgtcgatcttcgcctggacccgtggtctcgcccac
cgcgccaagctcgacaacaatccggaactcgccaaattcgcgaccacgctggagaaggtc
tgcgtctcgaccgtcgaagagggctacatgaccaaggacctcgcgctcctggtcggcgcc
gaccagcgctggctctcgaccaccggattcctcgacaaggtatccgacaacctcgtgaag
gcgatggccggctaa

DBGET integrated database retrieval system