KEGG   Bradyrhizobium sp. SK17: CWS35_31845Help
Entry
CWS35_31845       CDS       T05325                                 

Definition
(GenBank) N-acetyltransferase
  KO
K13018  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase [EC:2.3.1.201]
Organism
brk  Bradyrhizobium sp. SK17
Pathway
brk00520  Amino sugar and nucleotide sugar metabolism
brk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CWS35_31845
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:brk01005]
    CWS35_31845
Enzymes [BR:brk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.201  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase
     CWS35_31845
Lipopolysaccharide biosynthesis proteins [BR:brk01005]
 Unusual sugar
  CWS35_31845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Hexapep_2
Motif
Other DBs
NCBI-ProteinID: AUC98333
UniProt: A0A2K8YLF2
Position
complement(6863414..6864010)
Genome map
AA seq 198 aa AA seqDB search
MSEMREDPRFPGVLIHQSSYVDDGAVLGRGTKVWHFCHILPRTIIGENCSIGQNVMIGPN
VTIGNGCKIQNNVSIYDGVELADDVFCGPSCVFTNVNNPRADVSRKDEFRKTPIGRGTSI
GANATIVCGHSLGEYCFIGAGSVVTKDVPAFALMAGNPARRIGWMSRVGERLGKDLACPR
SGEIYVEADGRCFPKEAH
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagatgcgcgaggacccgcgtttccctggcgtcttgatccatcagtcgagctac
gtcgacgatggcgcagtccttgggcgcggcaccaaggtctggcatttctgtcacatcctg
ccgcgcaccatcatcggcgaaaattgctcgatcgggcagaacgtcatgatcggccccaat
gtcacgatcgggaacggctgcaagatccagaacaacgtctcgatctatgatggcgtcgag
ctcgcggacgacgtgttttgcggtccgagctgcgtcttcacgaacgtcaacaatccgcgc
gcagatgtttcgcggaaagacgaattccgcaagacgccgatcgggcgcggcaccagcatc
ggcgccaacgcgacgatcgtgtgcggacattcgctgggcgaatactgcttcatcggggcc
ggtagcgtcgtcacgaaggatgtacctgcgttcgcgctgatggcgggaaaccccgccagg
cggatcggctggatgagcagggtgggcgaacggctcggcaaggatctggcgtgcccgcgg
tcgggcgagatttacgttgaagccgacggtcgatgttttccgaaagaggcgcactag

DBGET integrated database retrieval system