KEGG   Bradyrhizobium sp. SK17: CWS35_33800Help
Entry
CWS35_33800       CDS       T05325                                 

Gene name
psd
Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
brk  Bradyrhizobium sp. SK17
Pathway
brk00564  Glycerophospholipid metabolism
brk01100  Metabolic pathways
brk01110  Biosynthesis of secondary metabolites
Module
brk_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:brk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CWS35_33800 (psd)
Enzymes [BR:brk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     CWS35_33800 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: AUC98667
UniProt: A0A2K8YM05
Position
complement(7272931..7273800)
Genome map
AA seq 289 aa AA seqDB search
MTVKGLISAFTQQEDLNFLLTNRIPRAAVTRFMGWFSKVENPLVRDASIACWKLFSDLDL
SEAKKTEFKSLHDCFTRELKPGLRPAVADPAIIASPSDAIIGAHGRIEDGQLFQVKGAPY
SLLDLLGDPALVEQHRNGRFVTLRLTSSMYHRFHAPYDFAIDKVTFIHGDVWNVNPIALK
RVERLFCKNERAVLRAKLSTGEPLTLVPVAAILVASLRLHFLDITLNAQSRGPVDFPCDA
HVKKGDELGWFEHGSTIIVLAPGNFEFCDNVAEGTRIKCGEPLLRKPVM
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgacagtcaagggcctgatctcggcattcacccagcaggaggacctcaatttcctgctg
accaaccggattccacgggctgcggtgacccgcttcatgggctggttctccaaggtagag
aacccgctggtgcgggacgcctcgatcgcctgctggaagttgttttccgacctcgacctg
tcggaagccaagaagaccgaattcaagagcttgcacgattgctttacccgcgagctgaag
cccggcctgcgcccggcggtggccgatcccgccatcatcgcgagcccgtcggatgcgatc
atcggcgcgcatggacggattgaggatgggcagttgttccaggtcaagggcgcgccgtat
tcgctgctcgatctgctcggcgatcccgcgctggtggagcagcacaggaacggccgtttc
gtcacgctgcggctgacgtcgagcatgtaccaccgcttccacgcgccctatgattttgct
atcgacaaggtgacgttcatccatggcgacgtctggaacgtcaatccgatcgcgctgaag
cgggtcgagcggctattctgcaagaacgagcgcgcggtgctgcgcgcgaaactgtcgacc
ggcgagccgctgactttggttccggtcgccgcgatcctggtcgcgagccttcggctgcat
ttcctcgacatcacgctgaatgcgcagtcgcgggggccggttgattttccctgtgacgca
catgtgaagaagggcgatgaactcggctggttcgagcacggttcgaccatcatcgtgctc
gcgcccggcaatttcgagttctgcgacaatgtcgcagagggaacgcggatcaaatgcggc
gagccgctgttgcgaaaacctgtgatgtga

DBGET integrated database retrieval system