KEGG   Bradyrhizobium sp. SK17: CWS35_34240Help
Entry
CWS35_34240       CDS       T05325                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
brk  Bradyrhizobium sp. SK17
Pathway
brk00480  Glutathione metabolism
brk00590  Arachidonic acid metabolism
brk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    CWS35_34240
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CWS35_34240
Enzymes [BR:brk01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CWS35_34240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AUD00011
UniProt: A0A2K8YQW0
Position
complement(7362710..7363186)
Genome map
AA seq 158 aa AA seqDB search
MATVYDFTAKSLAGEDMPLRQFEGQVLLIVNTASACGFTPQYKGLQELHAGLSPRGFAVL
GFPCNQFGAQEPGDARQIATFCETNYAVTFPMFAKIDVNGSGAHPLYEHLKREKSGLLGP
AIKWNFTKFLVDRAGKVVARHAPTARPEGLKKDIEALL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggcaacggtctacgacttcaccgccaagtcgctcgccggcgaggacatgccgttgcgg
cagttcgaggggcaggtgctgctgatcgtcaacacggcgagcgcctgcgggttcacgccg
caatacaagggcctccaggagctgcacgccggattgtcgccgcgcggctttgccgtgctc
ggcttcccctgcaaccagttcggcgcgcaggagcccggcgatgccaggcagatcgccaca
ttctgcgaaaccaactacgccgtgacgttcccgatgttcgccaagatcgacgtcaatggc
agcggcgcgcatccattgtacgaacacctgaaacgtgagaagtcgggcctgctcgggccc
gcgatcaaatggaacttcaccaagttcctggtcgatcgcgccggcaaggtcgtagcgcgg
catgcgccgaccgcccggcccgaaggattgaagaaggatatcgaggcgttgctatga

DBGET integrated database retrieval system