KEGG   Brevundimonas sp. LM2: BZG35_03130Help
Entry
BZG35_03130       CDS       T04750                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
brl  Brevundimonas sp. LM2
Brite
KEGG Orthology (KO) [BR:brl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BZG35_03130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 LTD
Motif
Other DBs
NCBI-ProteinID: AQR60755
UniProt: A0A1S6ERP1
Position
complement(624303..624707)
Genome map
AA seq 134 aa AA seqDB search
MHDSRPYEAETEGVIVRVRPAYLAGQSDPDEGRWVWAYQVEIENRGSQAVQLMARRWIIT
DGTGHVETVGGPGVVGEQPLIAPGDSYSYASGCPLPTPSGLMAGAYTMTDAAGRSFEATI
PTFSLDVPEGRVLN
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgcatgacagtcgcccctacgaagccgagaccgaaggcgtgatcgttcgcgtccgcccc
gcctatctggccggccagtccgatcccgacgaggggcgctgggtctgggcctatcaggtc
gagatcgagaaccggggctcgcaggccgttcagctgatggcgcgccgctggatcatcacc
gacggcacgggccatgtggagacggtcggcggtcccggcgtcgtcggcgaacagccgttg
atcgcgccgggcgacagctattcctacgcctcgggctgccccctgccgactccgtcgggc
ctgatggccggggcctataccatgaccgacgccgccggccgctcgttcgaggccaccatc
ccgaccttcagcctcgacgtgcccgagggacgggtgctgaactga

DBGET integrated database retrieval system