KEGG   Brevundimonas sp. LM2: BZG35_05065Help
Entry
BZG35_05065       CDS       T04750                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
brl  Brevundimonas sp. LM2
Pathway
brl00620  Pyruvate metabolism
brl00630  Glyoxylate and dicarboxylate metabolism
brl01100  Metabolic pathways
brl01110  Biosynthesis of secondary metabolites
brl01120  Microbial metabolism in diverse environments
brl01200  Carbon metabolism
Module
brl_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:brl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BZG35_05065
   00630 Glyoxylate and dicarboxylate metabolism
    BZG35_05065
Enzymes [BR:brl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BZG35_05065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AQR61103
UniProt: A0A1S6ESW6
Position
1004814..1006949
Genome map
AA seq 711 aa AA seqDB search
MPHHDRAGLSVDPQLSAFLEDEVLPGLGIGADGFWSGVAQIFARFAPENRVLLARRDDLQ
AQIDAWHVARKGQPHDPAATEGFLREIGYLVEEPAPFQVTTQNVDDELARLAGPQLVVPI
LNARFLLNAANARWGSLYDALYGTDALGDLPPAGGYDTARGARVVARAKAFLDEAVPLAA
GSHAEVTGWSVVDGALSPALKDPAQFVGYLGEPGAPSAILLANHGLHIELVIDRSSAIGA
ADAAGLSDVVLESALSTICDLEDSVAAVDAEDKVAAYRNCLGLMKGDLSARFSKGGQTLN
RTLEPDRSFTAPGGGAVTLKGRSLLFVRNVGHLMTNPAIRLPDGTEAPEGILDAIVTSLI
ALYDLKGLGGFTNSAAGSVYIVKPKMHGPQEAGFTDRLFDAVEDLLGLARHTIKVGVMDE
ERRTSANLAACIEAVKDRIVFINTGFLDRTGDEIHTAMQAGPMVRKADIKGSKWIAAYEA
RNVAIGLACGLSGRAQIGKGMWAAPDRMADMLEQKIGHPRTGANTAWTPSPTAATLHALH
YHAVDVFAVQTEVAARPTPGLEDLLTPPLAHGVNWSEQEVADELDNNAQGILGYVVRWID
QGVGCSKVPDIHDIGLMEDRATLRISSQHIANWLLHGVCTAEQVDAAFRRMAAKVDGQNA
GDPLYRPIAADPEGSLAYQAARALVFEGVAQPNGYTEPLLHAFRQRAKAET
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgcctcatcacgaccgcgccggcctgtccgtcgatccgcagctgtcggccttcctggag
gatgaggtgctgcccggcctcggaatcggggcggacggcttctggtcgggcgtcgcccag
atcttcgcgcggttcgcgccggagaatcgggtcctgctggcccgacgcgatgacctccag
gcgcagatcgatgcctggcacgtcgcccgcaagggacagccgcacgacccggcggcgacg
gaaggtttcctgcgcgagatcggctatctggtcgaggagcccgcgccgttccaggtcacc
acgcagaacgtcgacgacgagctggccaggctggccgggccgcagctggtggtgccgatc
ctgaatgcgcgcttcctgctgaacgccgccaatgcgcggtggggcagtctgtatgacgcg
ctttacggcaccgatgccctgggcgacctgccgccggcggggggctatgacaccgcccgg
ggcgcgcgcgtggtggcccgcgccaaggccttcctcgacgaggcggtgccgctggcggcg
gggtcgcacgccgaggtcaccggctggtcggtggtggacggggcgctgagcccggcgctg
aaggacccggcccaattcgtcggctatctgggcgagccgggggccccgtccgccatcctg
ctggccaaccacggcctgcacatcgaactggtcatcgaccggtccagcgccatcggggcc
gcggatgcggcgggcctgtcggacgtggtgctggagagcgccctgtcgaccatctgcgat
ctggaggactcggtcgcggccgtggacgccgaggacaaggtcgcggcctatcgcaactgt
ctggggctgatgaagggcgacctgtcggcccggttcagcaagggcggccagacgctgaac
cggacgctggagccggaccggtccttcacggccccggggggcggggcggtgaccctgaag
gggcggtcgctgctgttcgtgcgcaacgtcggccatctgatgaccaatccggccatccgt
ctgccggacgggaccgaggccccggaaggcattctggacgccatcgtgacctcgctgatc
gcgctgtacgacctgaaggggctgggtgggttcaccaactcggcggccgggtcggtctat
atcgtcaagccgaagatgcacggtccgcaggaggcgggcttcaccgaccggctgttcgac
gcggtcgaggacctgctggggctggcgcggcacacgatcaaggtcggggtgatggacgag
gagcggcgcaccagcgccaatctggcggcctgcatcgaagcggtgaaggaccggatcgtc
ttcatcaacaccggcttcctggaccgcaccggcgacgagatccacaccgccatgcaggcc
gggccgatggtgcgcaaggccgacatcaagggctcgaaatggatcgcggcgtacgaggcg
cgcaacgtcgccatcggcctggcgtgcggcctgtccgggcgggcccagatcggcaagggc
atgtgggcggcccccgaccggatggccgacatgctggagcagaagatcggccacccccgg
accggggcgaacaccgcctggaccccgtcaccgacggccgcgaccctgcacgcgctgcac
tatcacgccgtcgatgtcttcgcggtccagaccgaggtcgccgcccggccgacgccgggg
ctggaggacctgctgaccccgccgctggcgcacggggtcaactggtccgagcaggaggtg
gccgacgagctggacaacaatgcccagggcatcctgggctatgtcgtgcgctggatcgac
cagggggtgggctgttccaaggtgccggacatccacgacatcggcctgatggaggatcgg
gcgacgctgcggatcagctcgcagcacatcgccaactggctgctgcacggggtctgtacg
gcggaacaggtcgacgccgccttccggcgcatggcggccaaggtggacgggcagaacgcg
ggcgatccgctgtatcgcccgattgcggcggatcccgaaggctcgctggcctatcaggcg
gcgcgggccctggtgttcgagggggtggcccaacccaacggctataccgaacctctgctg
catgcgttcagacagagggcgaaggcggagacctga

DBGET integrated database retrieval system