KEGG   Brevundimonas sp. LM2: BZG35_16000Help
Entry
BZG35_16000       CDS       T04750                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
brl  Brevundimonas sp. LM2
Pathway
brl00071  Fatty acid degradation
brl00072  Synthesis and degradation of ketone bodies
brl00280  Valine, leucine and isoleucine degradation
brl00310  Lysine degradation
brl00362  Benzoate degradation
brl00380  Tryptophan metabolism
brl00620  Pyruvate metabolism
brl00630  Glyoxylate and dicarboxylate metabolism
brl00640  Propanoate metabolism
brl00650  Butanoate metabolism
brl00900  Terpenoid backbone biosynthesis
brl01100  Metabolic pathways
brl01110  Biosynthesis of secondary metabolites
brl01120  Microbial metabolism in diverse environments
brl01130  Biosynthesis of antibiotics
brl01200  Carbon metabolism
brl01212  Fatty acid metabolism
brl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:brl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BZG35_16000
   00630 Glyoxylate and dicarboxylate metabolism
    BZG35_16000
   00640 Propanoate metabolism
    BZG35_16000
   00650 Butanoate metabolism
    BZG35_16000
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BZG35_16000
   00072 Synthesis and degradation of ketone bodies
    BZG35_16000
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BZG35_16000
   00310 Lysine degradation
    BZG35_16000
   00380 Tryptophan metabolism
    BZG35_16000
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BZG35_16000
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BZG35_16000
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BZG35_16000
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:brl04147]
    BZG35_16000
Enzymes [BR:brl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BZG35_16000
Exosome [BR:brl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BZG35_16000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AQR62992
UniProt: A0A1S6EY72
Position
complement(3218388..3219563)
Genome map
AA seq 391 aa AA seqDB search
MTDVVIVSAARTPVGSFLGGLSSLPASKLGEIAIRAALERAGVDPAEVDEVILGHVLQAA
AGQGPARQAAMGAGIPKETPAWSLNQICGSGLRAVALGYQQIALGDAKIIVAGGQESMSQ
APHAQNLRAGQKMGDLAFTDTMIKDGLWDAFNGYHMGQTAENIAERFQISRADQDAFALA
SQHKAEAAQTAGRFADEIVPVVIAGRKGEVTVDQDEYIRHGATLESMEKLRPAFTKDGTV
TAANASGLNDGAAALVLMSAEDAKARGLEPLATIRSWATAGVDPAVMGTGPIPASRKALE
KAGWTVADLDRVESNEAFAAQSLCVLRELGLDPDKVNVNGGAIAIGHPIGASGARILTTL
LHELKRSGGARGLATLCIGGGMGVAMCVERV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgtcgtcatcgtctccgccgcccgcaccccggtcggatccttcctgggcggc
ctgtcgtccctgccggcctcgaaactgggggaaatcgccattcgggcggcgctggagcgg
gccggggtcgatccggccgaggtggacgaggtcatcctgggccatgtgcttcaggccgcc
gccggtcagggcccggcccgccaggccgcgatgggggccggcatccccaaggagaccccg
gcctggagcctgaaccagatctgcggctcgggcctgcgggcggtggcgctcggctatcag
cagatcgccctgggtgacgcgaagatcatcgtcgcgggcgggcaggagagcatgagccag
gcaccccacgcgcagaacctgcgcgccggccagaagatgggcgacctcgctttcaccgac
accatgatcaaggacgggttgtgggacgccttcaacggctaccacatggggcagacggcc
gagaacatcgccgagcggttccagatcagccgcgccgatcaggacgccttcgccctggcc
agccagcacaaggccgaggcggcccagaccgccggccgattcgccgacgagatcgtcccg
gtcgtgatcgccggtcgcaagggggaggtcacggtcgaccaggacgaatacatccgccac
ggcgcgacgctggagtcgatggagaagctgcgtcccgccttcaccaaggacggtacggtc
acggccgccaatgcctccggcctcaatgacggcgcggcggccctggtgctgatgtcggcc
gaggacgcgaaggcgagggggctggaacccctggccacgatccggtcctgggccaccgcc
ggcgtcgatccggcggtcatgggcacgggtccgatcccggcctccagaaaggcgctggag
aaggccggctggaccgtcgccgatctggaccgggtcgaatccaacgaggccttcgcggcc
cagagcctgtgcgtgctgcgcgaacttggcctcgatccggacaaggtcaacgtcaacggc
ggggccatcgccatcggccatccgatcggggcctccggcgcccgtatcctgaccaccctg
ctgcatgaactgaagcggtcgggcggcgcccggggcctggcgaccctgtgcatcggcggc
ggcatgggggtggccatgtgcgtcgaacgggtgtga

DBGET integrated database retrieval system