KEGG   Brachyspira murdochii: Bmur_0130Help
Entry
Bmur_0130         CDS       T01229                                 

Definition
(GenBank) CDP-glucose 4,6-dehydratase
  KO
K01709  CDP-glucose 4,6-dehydratase [EC:4.2.1.45]
Organism
brm  Brachyspira murdochii
Pathway
brm00520  Amino sugar and nucleotide sugar metabolism
brm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Bmur_0130
Enzymes [BR:brm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.45  CDP-glucose 4,6-dehydratase
     Bmur_0130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase Polysacc_synt_2 RmlD_sub_bind NAD_binding_4
Motif
Other DBs
NCBI-ProteinID: ADG70237
UniProt: D5U4J2
Position
complement(158903..159964)
Genome map
AA seq 353 aa AA seqDB search
METLEIKTIFEIFKNKNILITGHTGFKGAWLSKLLLEVGSNLSGISLKANDLSLYNLLSL
DKQLNSHILDIRDVDNIKKTVLDINPDIIFHLAAQPLVIDSYNRPLYTFETNVIGTINLM
EAMRQLNNLECAVMITTDKVYDNKEWVWGYRENDSLGGHDPYSSSKACTEIAIKSYKKSF
FKDLNIVSVRAGNVIGGGDFADNRIIPDIVRAIEKNIPVELRNPNSVRPWQHVLDVLYGY
LLLAYNIINKNDVSDSYNFAPIDEGNKFTVEYITKCFIDNIGKGSYKVNIQDTNKKEMNM
LRLDSSLARKELKWNERFNTEEAIKQTAIWYKEYLNNNDLNIITDKQIKEYIN
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggaaactttggaaataaaaacaatatttgagatatttaaaaataaaaatattttaatt
acaggtcatacaggatttaaaggagcctggctttcaaaattgttattagaagtaggttct
aatctgagcggaatatctttaaaagctaatgatttatctctatataatttgttatctctg
gataaacaattaaattcgcatatattagatattagagatgtagataatataaaaaaaaca
gttttagatattaatcctgatataatttttcatttagcagctcagcctcttgttatagat
agctataacagaccattatatacatttgaaactaatgttattggtactattaacttaatg
gaagctatgaggcaattaaataatttagaatgtgcagttatgattacaactgataaggtt
tatgataataaagaatgggtttgggggtatagagaaaatgattctttaggcggtcatgat
ccatattcatcctctaaggcttgtactgaaatagctataaaaagttataaaaaatcattt
tttaaagatttaaatatagttagcgtaagagcaggtaatgttataggcggaggggatttt
gctgataatagaataatacctgatatcgtgagggctatagaaaaaaatattcctgtagaa
ttaagaaatcctaatagtgtaagaccttggcagcatgtacttgatgtgctttatggatat
ttattacttgcttataatataattaataaaaatgatgtgtctgatagttataatttcgcc
cctatagatgaaggaaataaatttactgttgagtacataaccaaatgttttatagataat
attggaaaaggcagttataaagtaaatattcaagatacaaataaaaaagagatgaatatg
cttagattagattcatcccttgcaagaaaagaattaaaatggaatgaaagatttaataca
gaagaagctataaaacaaactgctatttggtataaagaatatttaaataataatgattta
aatataataactgataaacaaataaaagaatatattaattga

DBGET integrated database retrieval system