KEGG   Brachyspira murdochii: Bmur_0335Help
Entry
Bmur_0335         CDS       T01229                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine/D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
brm  Brachyspira murdochii
Pathway
brm00471  D-Glutamine and D-glutamate metabolism
brm00550  Peptidoglycan biosynthesis
brm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Bmur_0335
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Bmur_0335
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:brm01011]
    Bmur_0335
Enzymes [BR:brm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     Bmur_0335
Peptidoglycan biosynthesis and degradation proteins [BR:brm01011]
 Precursor biosynthesis
  Amino acid ligase
   Bmur_0335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: ADG70440
UniProt: D5U5U9
Position
complement(426451..427866)
Genome map
AA seq 471 aa AA seqDB search
MILDLNKTYIKVLKKQNILILGAAVRSGVSIANILYDINTTLNINIKYALSDSKTEEQLQ
DSIEALKDKNAKLFFGNQEISILDGITLIIISPGIPHTIDIVKEAKRRGIKIIGEIEFAY
NLLPNRNYIAVTGTDGKTTTVTLIYKIISSYKKARLVGNVGNTFSKELETIEPDEDIVLE
LSSFQLETVEKFHAHIAAILNIAEDHLDRYKDIEEYFNAKKNISINQNKNDFLILNYDNI
YTNIWYNELNNNCKMKLLTFSLKSKFADIYYNEEDEYIYYENEKLFSIKERKILGKHNVA
NILAAVLVCLKDNIPAEHIEHVVNNFKGIEHRVELVAEINGVKYINDSKATSMNAVMSAL
KSFDKDIILIMGGRNKNIDFTSLNNLIESRVKKLILIGEAAEALDDMIHFENKIIIKDFT
DAFNYASAISINGDTVLLSPGCASFDMFKNYEERGKYFKSLVYKLDSITKE
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgattcttgatttgaataaaacatatataaaagtcctaaaaaaacaaaatattttgata
ttgggggctgctgtaagaagcggagtgagtatagcaaatattttatacgatattaataca
actttaaatatcaatataaaatatgctttaagcgacagtaaaacagaagaacagcttcag
gatagtatagaggcgttaaaagataaaaatgccaaacttttttttggaaatcaggaaata
tctattttagatggtataactcttataataatttctccgggtattcctcatactatagat
atagtaaaagaggctaaaagaagaggcataaaaataataggtgagatagagtttgcatat
aatcttctgcctaatagaaattatatagcagtaacaggtacagacggaaaaactactaca
gttactcttatttataaaataataagttcatacaaaaaggcaagacttgttggtaatgta
ggaaatactttttctaaagagcttgaaactatagagccagatgaagatattgtattagag
ctttcaagttttcaattagaaacagttgagaaatttcatgctcatatagcagccatatta
aatatcgcggaagatcatcttgacagatacaaagatatagaagagtatttcaatgccaaa
aaaaatataagtatcaatcaaaataaaaatgattttcttatacttaattatgataacatt
tatactaatatttggtataatgaacttaataataactgcaagatgaaacttttgactttt
tcactaaaaagcaaatttgcagatatttattataatgaagaagatgagtatatatattat
gagaatgaaaaattattctctataaaagaaagaaaaatattaggcaaacataatgtagca
aatatacttgcagcagttttagtatgtttgaaagataatataccagcagagcatatagag
catgttgttaataattttaagggtatagaacatagggtagagttggttgctgagataaac
ggtgttaaatatattaatgattctaaagctacatctatgaatgctgttatgagtgcttta
aaatcttttgataaggatataatacttataatgggcggacgtaataaaaatatagatttt
acttctttaaataatcttatagaaagcagagtaaaaaaattaatacttattggagaggcc
gctgaagctcttgatgatatgatacattttgagaataagattattataaaagattttaca
gatgcttttaattatgcttctgcaatatctataaatggtgatactgttttactttctccg
ggctgtgccagttttgatatgtttaaaaattatgaggagagagggaagtattttaaaagt
ttggtctataaactagatagtattacaaaagaataa

DBGET integrated database retrieval system