KEGG   Brachyspira murdochii: Bmur_0979Help
Entry
Bmur_0979         CDS       T01229                                 

Definition
(GenBank) 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
brm  Brachyspira murdochii
Pathway
brm00900  Terpenoid backbone biosynthesis
brm01100  Metabolic pathways
brm01110  Biosynthesis of secondary metabolites
brm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:brm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bmur_0979
Enzymes [BR:brm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Bmur_0979
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C DUF1640
Motif
Other DBs
NCBI-ProteinID: ADG71075
UniProt: D5U8Q2
Position
complement(1149580..1150449)
Genome map
AA seq 289 aa AA seqDB search
MHIIKAPCKINISLDITSKREDGYHLIESLFHTVNLYDIISIEKSDKYSIHTNGMFALKD
DEEDNIVTKVFNYFKNEMGLIDNYNINIEKNIPTGAGLGGGSSDAANIIKFFLSELNIDI
NDSLIESFSRFGADIPFFIRGGLVWVSGIGEKIKNYNFILPYNIILIYPNIHVSTKLAYS
KFVKDDFNKSDIFAIKNMLDNGEGFNKDINFNDIVSNTYNIFEKNVFNLDKRIEDIKLHA
ENIIKRKVSMSGSGSSLFALYENNDKKIDDDFNKLKSEMNYNIYKLSLI
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcatataataaaagctccatgcaaaattaatatttctctcgatattacatcaaaaaga
gaagacggatatcatctcatagaatctttatttcatacagtaaatctatatgatattata
agtatagaaaagtctgataaatacagcattcatacaaatggaatgtttgcattaaaagat
gatgaggaagataatatagtaactaaagtatttaattattttaaaaatgaaatggggctt
attgataattataatataaatattgaaaaaaatattcctacaggagcaggtcttggcgga
ggatcttctgatgctgctaatattatcaagttttttttaagcgaacttaatattgatatt
aatgatagtttgatagaatcattttctaggtttggtgctgatattcctttttttataagg
ggaggtttagtttgggtttctggaataggtgagaagataaaaaattataactttatactg
ccttataatattattttgatatatcctaatatacatgtatctacaaaattagcttattca
aagtttgttaaagatgattttaataaatctgatatatttgctataaaaaatatgcttgat
aatggagaaggttttaataaagatattaattttaacgatatagtttctaatacgtataat
atatttgaaaaaaatgtatttaatttggataaaagaatagaagatataaaactacatgca
gaaaatataataaaaagaaaagtatccatgagcggttctgggtcttcgctttttgcttta
tatgaaaataatgataaaaaaatagatgatgactttaataaattaaaatcagaaatgaat
tataatatttataaattaagtttgatttaa

DBGET integrated database retrieval system