KEGG   Brachyspira murdochii: Bmur_1403Help
Entry
Bmur_1403         CDS       T01229                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
brm  Brachyspira murdochii
Pathway
brm00010  Glycolysis / Gluconeogenesis
brm00260  Glycine, serine and threonine metabolism
brm00680  Methane metabolism
brm01100  Metabolic pathways
brm01110  Biosynthesis of secondary metabolites
brm01120  Microbial metabolism in diverse environments
brm01130  Biosynthesis of antibiotics
brm01200  Carbon metabolism
brm01230  Biosynthesis of amino acids
Module
brm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
brm_M00002  Glycolysis, core module involving three-carbon compounds
brm_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:brm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bmur_1403
  Energy metabolism
   00680 Methane metabolism
    Bmur_1403
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bmur_1403
Enzymes [BR:brm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Bmur_1403
Membrane trafficking [BR:brm04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Bmur_1403
Exosome [BR:brm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Bmur_1403
  Exosomal proteins of melanoma cells
   Bmur_1403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADG71493
UniProt: D5U9X0
Position
complement(1606994..1607740)
Genome map
AA seq 248 aa AA seqDB search
MTKVVLIRHGESVWNKENLFTGWADVTLSEKGIEEAKAGGAELKKAGFTFDKAYTSTLTR
AIKTLNLVLEEMGLLWIPVEKCWQLNERHYGALQGLNKSQTAEKYGEDQVKIWRRSYDTP
PPALTKDDERYPGHDPRYKNLSEKELPLTECLKDTVARVVPFWENVILPDIKAGKKIIIA
AHGNSLRALVKYLDNISDADITELNIPTGMPLVYELDDNFKAVNKQYLGDPEAVKKAMEA
VANQGKKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagttgttttaatacgtcatggtgagagcgtatggaataaagaaaatttattt
acaggctgggcagatgtaactttgtctgaaaaaggtatagaagaagctaaagcaggcgga
gcagaacttaaaaaagcaggatttacttttgataaagcatatacttctactttaacacgt
gctatcaaaactttaaatctagttttagaagaaatgggacttttatggataccagtagag
aaatgctggcagttaaatgaaagacattacggagcattacaaggcttaaataaatcgcaa
acagctgaaaaatacggagaggatcaggtaaaaatctggagaagaagctatgatactccg
cctccagctttgacaaaagatgatgaaagatatccgggtcatgatccgcgttataaaaac
ttatcagaaaaagaactccctttaacagaatgtttaaaagatactgtggcaagagtagta
cctttttgggaaaatgttatacttccggatattaaagctggaaaaaaaatcatcatagca
gcacatggaaacagtttaagagcattagtaaaatatttagacaatatctctgatgctgac
attacagagcttaatatacctactggaatgcctttagtttatgagcttgatgataatttt
aaagctgtaaacaaacagtatttaggcgaccctgaagctgttaaaaaagctatggaagca
gtagctaatcaaggtaaaaagaagtaa

DBGET integrated database retrieval system