KEGG   Brachyspira murdochii: Bmur_1768Help
Entry
Bmur_1768         CDS       T01229                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
brm  Brachyspira murdochii
Pathway
brm00010  Glycolysis / Gluconeogenesis
brm00020  Citrate cycle (TCA cycle)
brm00620  Pyruvate metabolism
brm00640  Propanoate metabolism
brm00650  Butanoate metabolism
brm00680  Methane metabolism
brm01100  Metabolic pathways
brm01120  Microbial metabolism in diverse environments
brm01130  Biosynthesis of antibiotics
brm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:brm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bmur_1768
   00020 Citrate cycle (TCA cycle)
    Bmur_1768
   00620 Pyruvate metabolism
    Bmur_1768
   00640 Propanoate metabolism
    Bmur_1768
   00650 Butanoate metabolism
    Bmur_1768
  Energy metabolism
   00680 Methane metabolism
    Bmur_1768
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Bmur_1768
Enzymes [BR:brm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Bmur_1768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: ADG71850
UniProt: D5UAX7
Position
complement(2019029..2021293)
Genome map
AA seq 754 aa AA seqDB search
MANKYNLAEQENILESGNELAAIAAAQINYHVMGYYPITPSTQIAEYLDEMKANGRHTVC
MIPGDGEHGAAGICYGAATAGGRVFNATSANGLLFAMEQLPVQSGTRFPMVLNVVNRTVS
GPLDIKCDQSDIMMALNTGWIIIMAHTTQMVYDFNIFALKIAERAKLPIIVSSDGFFTSH
QKKKIHLFKNDKDVQDFLGKYTPEVTSVEPGKNPVTIGPYMNEDELTGSKLQLSQALEDA
RAIILDVFEEFASFSGRKYSPIETYNMEDAEVALMLCGSAYETGTLAVDEMRKANPNLKI
GAFAITQIRPFPEKELQKLLANVKVVVVGDRQDSYSGMGGNMSTEIRAALKNDPNNKSSI
VSRVYGLGGTEFTLEKAKELFDLGLKELANPGSVEKHSYLEQYMGDPNVKMKPIHEPLTL
ESQKSGITVTMNEQTHKLEVKTPPLRELTGKAYRYAQGHGACNGCGIFSGINTFMKGIEG
EVVLLVHTGCSMVVTTGYPYSSYRTTYVHNLFQNGAATLSGIVEMYHERKRRGEIEGPED
PTFIMVTGDGGHDIGMGPSIGAAIRNHKMIILEYDNEGYMNTGNQLSFSTPLGHRTSTSN
VGKAEVGKQFNHKDVAQIFAGCHIPYVATGCEAYPLDLVKKAAKAQWYANHHGTAFVKLL
IACPLNWKSPDDMGKDVIKAAVDCCFFPLYEIEHGITTITNMVADDKKQPVTEWLKMMGK
TKHLLKHQDLLDAFQKEVDRRWYRLKAMHESPLL
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atggctaataaatataatcttgctgaacaagaaaacatacttgaaagtggtaatgaatta
gcagccattgcagccgctcaaatcaattatcacgttatgggttattacccaattacgcct
tctactcagattgctgagtacttagacgaaatgaaagctaacggaagacacacagtatgc
atgatacctggtgatggtgaacatggtgctgcaggtatatgttacggtgctgctactgca
ggaggaagagtatttaatgctacttctgctaacggtcttctttttgctatggagcaatta
cctgtacaatcaggtactagattccctatggtattaaatgttgtaaacagaacagtttct
ggtccgctagacattaaatgtgaccaatccgacataatgatggctcttaacactggttgg
attatcattatggctcatactactcaaatggtttatgacttcaatatctttgctttgaaa
atcgctgaaagagctaaattacctattatagtttcttctgacggtttctttacttctcac
caaaagaaaaaaattcacctattcaaaaatgataaagatgttcaggatttcttaggtaaa
tatactccagaagttacttctgttgaacctggaaaaaatcctgttacaatcggaccttac
atgaatgaagatgaattaacaggaagtaaattacagctttctcaagctttagaagatgct
cgtgctataattttagatgtatttgaagagtttgcttctttctctggaagaaaatactct
cctatagaaacttacaatatggaagatgctgaagtagctttaatgctttgcggttctgct
tatgaaactggtactttggctgttgatgaaatgagaaaagctaatcctaatcttaaaatt
ggtgcttttgctattactcaaattcgtcctttcccagaaaaagaattacaaaaattactt
gctaatgttaaagtagttgttgtaggagacagacaagattcatactctggtatgggcggt
aatatgtctaccgaaatcagagctgctcttaaaaatgatcctaataacaaatcttctatc
gttagcagagtttatggtcttggcggtactgagtttactttggaaaaagctaaagaatta
ttcgatttaggtttgaaagaattagctaatccaggttctgtagaaaaacattcttactta
gaacaatatatgggcgatcctaatgttaaaatgaaacctatacatgaacctcttactttg
gaaagccaaaaatccggcatcactgttactatgaatgaacaaactcataaacttgaagtt
aaaactcctcctcttagagaattaactggtaaagcttatcgttatgctcaaggtcatggt
gcttgtaacggctgcggtattttctctggtatcaatactttcatgaaaggtatagaaggc
gaagttgttcttttggtacatactggttgttctatggttgttactacaggttatccttac
agctcttacagaactacttatgttcacaacttgttccaaaatggtgctgctactctttct
ggtatagtagaaatgtatcatgaaagaaaaagaagaggtgaaatcgaaggaccagaagat
cctactttcataatggttactggagacggcggtcatgacataggtatgggaccttctatt
ggtgctgctataagaaatcacaaaatgattatattagaatatgataatgaaggatacatg
aacactggtaaccaattatcattctctactccattgggacacagaacttctacttctaac
gttggtaaagctgaagttggtaaacaattcaaccacaaagatgtagctcaaatatttgct
ggatgtcatatcccttatgttgctaccggctgtgaagcttatccattagatttagttaaa
aaagctgctaaagctcaatggtatgctaaccatcatggtactgcttttgttaaacttctt
attgcttgtccattaaactggaaatctccagatgacatgggtaaagatgttatcaaagct
gctgttgactgctgtttcttcccattgtatgaaatagaacatggtatcactactatcact
aatatggtagctgatgataaaaaacagcctgttactgaatggcttaaaatgatgggtaaa
actaaacaccttcttaaacatcaagacttacttgatgcattccaaaaagaagttgataga
agatggtatcgcttaaaagctatgcatgaaagtcctcttctataa

DBGET integrated database retrieval system