KEGG   Brachyspira murdochii: Bmur_2362Help
Entry
Bmur_2362         CDS       T01229                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
brm  Brachyspira murdochii
Pathway
brm00010  Glycolysis / Gluconeogenesis
brm00030  Pentose phosphate pathway
brm00051  Fructose and mannose metabolism
brm00052  Galactose metabolism
brm00680  Methane metabolism
brm01100  Metabolic pathways
brm01110  Biosynthesis of secondary metabolites
brm01120  Microbial metabolism in diverse environments
brm01130  Biosynthesis of antibiotics
brm01200  Carbon metabolism
brm01230  Biosynthesis of amino acids
brm03018  RNA degradation
Module
brm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:brm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bmur_2362
   00030 Pentose phosphate pathway
    Bmur_2362
   00051 Fructose and mannose metabolism
    Bmur_2362
   00052 Galactose metabolism
    Bmur_2362
  Energy metabolism
   00680 Methane metabolism
    Bmur_2362
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Bmur_2362
Enzymes [BR:brm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Bmur_2362
Protein phosphatases and associated proteins [BR:brm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Bmur_2362
Messenger RNA biogenesis [BR:brm03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Bmur_2362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ADG72434
UniProt: D5U5F7
Position
complement(2668786..2669766)
Genome map
AA seq 326 aa AA seqDB search
MSDIKKIGVLTSGGDASGMNPAIRSVVRTAIANGLEVMGIKEGYQGLMYNDVYPMTAGSV
GGIINHGGTILFSARSPEFQTEDGMKKAADNMRYHGMDALIVIGGDGTYKGALDFYNHHP
DFPIVAIPGTIDNDIFGTDYTIGYDTAVNVAMDAIDKLRDTATSHGRCFVVEVMGRHAGY
IALEVGIASGAEDILIPETPTDMDKIVEELQIAKKRGKKSSIIVVAEGDESGGAMEVAKQ
IEGKTGFDTRVTILGHMQRGGSPTSRERLMAARFGYIAVKALLEGKKNVAVGIWKGEYTY
TPLTDAVKKVPKVDPIDLALCRTLAI
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatataaaaaaaattggtgtattaacaagcggaggagatgcctctggaatgaat
cctgctataagaagtgttgtaagaacagcaatagccaatggtttggaagtaatgggaatt
aaagagggctatcaaggacttatgtataatgatgtatacccaatgacagctggaagtgtt
ggaggcatcattaatcatggaggaactatattattttctgcaagatcacctgaatttcaa
acagaagacggtatgaaaaaagccgctgataatatgagatatcatggtatggacgcctta
atagtaataggcggagacggaacttataaaggggctttggatttttataatcatcaccct
gattttcctatagtagcaataccgggtactattgacaatgatatttttggtactgattat
actataggttatgatacggctgttaatgtagcaatggacgctattgataaattaagagat
actgctacaagccatggaagatgctttgtcgtagaagttatgggaagacatgccggatac
atagcattagaagtaggaatagcttcaggagctgaggatatacttatacctgagactcct
actgatatggataaaatagtagaagaattgcaaatagctaaaaaaagaggaaaaaaatct
tctattatagttgttgctgaaggtgatgagtctggcggagctatggaagtagctaaacaa
atagaaggtaaaactggttttgatacacgtgttactatactcggtcacatgcaaagagga
ggatcccctacttcaagagaacgcttaatggctgcaagattcggatatattgctgttaag
gctttactagaaggcaaaaaaaatgtggctgttggtatttggaaaggagaatatacttat
actcctttaacagatgctgtaaaaaaagtgcctaaagttgatcctatagacttagcacta
tgcagaacacttgctatataa

DBGET integrated database retrieval system