KEGG   Breoghania sp. L-A4: D1F64_07830Help
Entry
D1F64_07830       CDS       T05594                                 

Definition
(GenBank) bifunctional [glutamine synthetase] adenylyltransferase/[glutamine synthetase]-adenylyl-L-tyrosine phosphorylase
  KO
K00982  [glutamine synthetase] adenylyltransferase / [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase [EC:2.7.7.42 2.7.7.89]
Organism
brn  Breoghania sp. L-A4
Brite
KEGG Orthology (KO) [BR:brn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    D1F64_07830
Enzymes [BR:brn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.42  [glutamine synthetase] adenylyltransferase
     D1F64_07830
    2.7.7.89  [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase
     D1F64_07830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlnE GlnD_UR_UTase DUF294 DUF294_C
Motif
Other DBs
NCBI-ProteinID: AXS39987
UniProt: A0A346R0H8
Position
1676724..1679684
Genome map
AA seq 986 aa AA seqDB search
MTEPTNGALSARISVVPPCADAAHGEELIADLVARAGKAEGGEALCAAIRADQRLRAFLA
GVFFNAPFLRDLAMQDPQRLSRIVAGDPEAAITTLERDLAAFRPTDEADLSRALRRAKQE
AALAIGLADLAGIWPVMQVTCALTRVADAALGAAIRFLLSDMAARGRYVPRYPDDPAKGS
GWIILAMGKYGAFELNYSSDIDLIVLFDAARAGLPEGVEPAMEFVRATKRLVKIMQERTA
DGYVFRTDLRLRPDPGATPPALGMENALIYYESMGQNWERAALIKARPCAGDIEAGDDFL
REIVPFIWRKSLDFAAIADVHSMKRQIHAHKGHGVIAVAGHNVKLGRGGIREIEFFVQTQ
QLIAGGRNPDLRRRGTLEMLDLLVEATWVDADTRAELAEAYCFLRAVEHRIQMVNDEQTH
TLPDNDEGLARIAALMGMPDRETFDAALRQRLRTVQGHYAELFEAEPELSSELGNLVFTG
GDDDPGTLETLSSLGFKRPSDAIRIVSAWHFGRYPAMRSAKARERLTELHPALIDAFSQT
DNPDGALAAFDRFLAGLPSGVQLFSLLRSNPHLLKLLATVMGEAPRLAEIVSKRSRVLDA
MLDPAFFDAMPREKEFADRLRTSLADARSYEETLDRMRIFAQEQQFLIGVRLLGDALAVG
RAGRAYARLAEVVVRDLLEAAKQHLAEAHGAVEGGQVVVLAMGKLGSLEMTPTSDLDLIV
LYDFPDDVTASEGPRPLSPSQYFIRLTQRLLAALSAPTAEGTLYEVDFRLRPSGNAGPLA
TRFAGFADYQREKAWTWEHMALTRARVIAGDADLWERTTAVIEDVLRSPRDIPALRRDVA
SMRARIEAEKGSTDRWALKEVAGGLVDVEFIGQYLQLANAAAHPEILAHASLDALTKAGE
AGLLAADDAELLVRATRLYQGLMQILRLSVAGKFSAEAAPRGVLDLLARVSNEPDFSRLE
AHLDETQTAVRAAFERIIGPVVRSEG
NT seq 2961 nt NT seq  +upstreamnt  +downstreamnt
atgacagagccgaccaatggggcgctcagcgcgcggatcagcgtggttccgccatgcgcg
gatgccgcgcatggcgaggaattgatcgcggatcttgttgcccgcgccgggaaagctgag
gggggcgaggcgctttgcgccgcgattcgcgccgatcagaggctgcgggcgtttctcgca
ggggtgtttttcaacgcgccgttcctgcgcgatctcgccatgcaggacccgcagcgtctg
tcgcggattgtcgcgggcgaccccgaagcggcgatcacgacgctggagcgcgatctcgcc
gccttccgtcccactgacgaggccgatctgtcacgcgccctgcgccgcgccaagcaggag
gcggcgcttgccatcgggcttgccgatctcgcgggcatctggccggtgatgcaggtgacg
tgcgccctgacgcgcgtcgccgatgcggcgcttggggcggccatccgctttctcctttcc
gacatggccgcgcgcggccgttatgtgcccaggtatccggacgatcccgccaagggaagc
ggctggatcattctggcgatgggcaaatatggcgccttcgagctcaactattcctccgac
atcgatctcatcgtgctgttcgacgcggcgcgggccggcctgcccgagggcgtcgagccg
gcgatggaattcgtgcgcgccaccaagcggctggtgaaaatcatgcaggagcgcaccgcc
gacggctatgtgttccgcacggatctgcggctcaggcccgatcccggcgcgacgccgccg
gcgctggggatggaaaacgcgctgatctactacgagagcatgggccagaactgggagcgc
gcggcgctgatcaaggcccggccctgcgccggagacatcgaggcgggcgacgatttcctg
cgcgagatcgtgccgttcatctggcgcaagtcgctggatttcgcggcgatcgccgatgtg
cattcgatgaagcggcagattcacgcgcacaagggccatggcgtcatcgcggtggcgggt
cacaacgtgaagctcgggcgcggcggcatccgcgagatcgagttcttcgtgcagacgcag
cagttgatcgcaggcggccgcaacccggatctgcgccgccgcggaaccctggagatgctg
gatctgctggtggaggccacgtgggtggacgccgatacccgcgcggagcttgccgaggcc
tattgtttcctgcgcgccgtcgaacaccgcatccagatggtcaatgacgagcagacccat
acgctgcccgacaacgacgagggactggcgcgtatcgccgcgctgatgggcatgcctgat
cgcgagacattcgacgcggcgctcaggcagcgcctgcgcacggtgcaggggcattacgcg
gagctgttcgaggcggagccggagctgtcgtcggaactgggcaacctggtgttcaccggc
ggggacgacgatccgggcacgctggagacgctgagctcattgggtttcaagcggccgagc
gacgccatccgcatcgtcagcgcctggcatttcggccgctatcctgcgatgcgatcggcc
aaggcgcgtgaacggctgaccgagctgcatccggcgctgatcgacgccttcagccagacc
gacaacccggatggcgcgctggcggcgtttgaccggtttctggcggggctgccctccggc
gtgcagcttttctcgctgctgcgctccaacccgcatctgctgaagctgctggcgacggtg
atgggcgaggcgccacggctggccgaaatcgtctccaagcggtcaagggtgctggacgcg
atgctcgatcccgcgttcttcgacgccatgccgcgggagaaggaattcgccgaccgcctg
cgcacatcgctcgccgacgcgcgctcctatgaggagacgctggaccgcatgcgcatcttc
gcccaggagcagcagttcctcatcggcgtgcggcttctgggcgacgcgctcgcggtgggc
cgggcgggccgtgcctatgcgcggctggccgaggtggtggtgcgcgaccttctggaagcc
gccaagcagcatcttgccgaggcgcacggcgcggtcgagggcggacaggtggtggtgctg
gccatgggcaagctcggcagcctggagatgacgccgacgtcggatctcgacctgatcgtg
ctgtacgattttcccgacgacgtcacggcgagcgaggggccccggccgctttctccgagc
cagtatttcattcgcctgacccagcggcttctggcggcgctttccgcgcccaccgccgaa
ggcactctgtatgaggtggacttccgcctgcggccgtccggcaacgccgggccgctggcc
acacggttcgcgggctttgcggactatcagcgcgagaaggcctggacgtgggagcacatg
gcgctgacccgcgcccgggtgatcgcgggcgatgcggacctttgggagcgcaccacggcg
gtgattgaggacgtgctgcgcagcccgcgcgatatcccggccttgcgccgggacgtggcc
tccatgcgcgcgcggattgaggcggagaagggatcgacggaccgctgggcgctgaaggag
gtggccggcgggctggtcgacgtggagttcatcggacaatatctgcagttggccaatgcc
gccgcccatcccgaaatcctggcgcacgcgagcctggacgccctgacgaaggccggggag
gccggtttgctggcggcggacgacgcggagctgctggtgcgcgcgacgcggctgtatcag
ggcctgatgcagatcctgcggctgtcggttgctgggaaattctccgccgaggccgcgccc
agaggcgtgctggatctgctggcgcgggtcagcaacgagcccgatttctcgcgcctcgag
gcgcatctggacgaaacccagaccgccgtccgcgccgctttcgagcgcattattgggcct
gttgtaaggtcggaggggtga

DBGET integrated database retrieval system