KEGG   Breoghania sp. L-A4: D1F64_08720Help
Entry
D1F64_08720       CDS       T05594                                 

Definition
(GenBank) anion permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
brn  Breoghania sp. L-A4
Brite
KEGG Orthology (KO) [BR:brn00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    D1F64_08720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF485
Motif
Other DBs
NCBI-ProteinID: AXS40131
UniProt: A0A346R0X2
Position
complement(1878247..1879773)
Genome map
AA seq 508 aa AA seqDB search
MTLKTDADVLPQAHSKKTSLDKDLDKIVHVEYAARRISQRLVAPGLALLFLSLTAAFAAS
QTGVQTSAVFIVIAAMLGGYMALNIGANDVANNVGPAVGSRALTMTGALIIAAVFESAGA
LLAGGDVVSTISKGIIDPSLVPDSQTFIWAMMAALLSSALWVNLATWIGAPVSTTHSVVG
GVMGAGIAAVGFGAVNWTTMSMIAASWVISPVLGGVIAALFLAFIKANIIYRDDKIAAAR
RWVPLLLATMAGVFSCYLAMKGLKKVWKADATAIAVIGVATFALCWAIAKPWVHRQSEGM
ENRNQSLRRLFHLPLICSAALLSFAHGANDVANAVGPLAAILHAVQSGDIVAKVGIPVWV
MMIGAAGISLGLFLYGPRLIRMVGEQITKMNPMRAYCVALSAAITVIVASAFGLPVSSTH
IAVGAVFGVGFFREYYTAKSKRRADYLRAKRNDSDTALDSDYQAPEEISRRKLVRRAHFT
TIIAAWIITVPAAALLSAGLFLGLTLMQ
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgaagaccgacgccgacgtgctgcctcaggcgcactccaagaagacgtccctg
gacaaggatctcgacaagatcgtccatgtcgaatacgcggcgcgcaggatctcccagcgc
ctcgtcgctcccggtctggcgctgctgttcctgtcgctcaccgccgccttcgccgccagc
cagaccggcgtgcagaccagcgccgtgttcatcgtcatcgcggccatgctgggcggctac
atggcgctgaacatcggcgccaacgacgtggccaacaacgtcggtcccgcggtcggctcg
cgcgccctgaccatgaccggcgcgctgatcatcgccgccgtgttcgaaagcgccggtgcg
ctgctggccggcggcgacgtggtctcgaccatctccaagggcatcatcgatccctcgctg
gtgcccgacagccagacgttcatctgggcgatgatggcggcgcttctgtcctccgcgctg
tgggtcaatctcgccacctggatcggcgcgcccgtctccaccacccattccgtggtcggc
ggcgtcatgggcgccggcattgcggccgtgggcttcggcgccgtcaactggacgacgatg
agcatgatcgccgcgagctgggtgatctcaccggtcctcggtggtgtcatcgcggcgctg
ttcctggcgttcatcaaggccaacatcatctaccgcgacgacaagatcgccgccgcgcgg
cggtgggtgccgctgctgctggcgaccatggccggcgtcttctcctgctatctggcgatg
aagggcctgaagaaggtctggaaggccgacgccacggccatcgccgtcattggcgtcgcc
acgttcgcactgtgctgggcgatcgcgaaaccctgggtgcaccggcagtccgaggggatg
gagaaccgcaaccagtcgctgcgcaggctcttccaccttcccttgatatgttccgccgcc
ctgctctccttcgcccatggcgccaacgacgtggccaacgccgtaggccccctggccgcc
atcctgcacgcggtgcaatccggcgacatcgtcgccaaagtcgggattcccgtctgggtg
atgatgatcggcgccgcgggcatcagcctcgggctgtttctctacggcccacgcctgatc
cgcatggtcggcgagcagatcaccaagatgaacccgatgcgcgcctattgcgtggcgcta
tcggccgccatcaccgtgatcgtcgcctcggccttcggcctgccggtgtcctcgacgcat
atcgccgtgggcgcggtcttcggcgtcggcttcttccgcgagtactacaccgccaagagc
aagcgccgggccgactacctgcgcgccaagcgcaacgattccgataccgcgctcgactcc
gactaccaggcgccggaagaaatctcgcggcgcaaactggtgcggcgcgcgcatttcacc
accatcatcgccgcgtggatcatcaccgttccggcggcggcgctactgtcggccgggctt
ttcctcggcctgacactgatgcagtga

DBGET integrated database retrieval system