KEGG   Bradyrhizobium sp. ORS 285: BRAD285_2027Help
Entry
BRAD285_2027      CDS       T04956                                 

Gene name
rfaD
Definition
(GenBank) ADP-L-glycero-D-mannoheptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
bro  Bradyrhizobium sp. ORS 285
Pathway
bro00540  Lipopolysaccharide biosynthesis
bro01100  Metabolic pathways
Module
bro_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:bro00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    BRAD285_2027 (rfaD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:bro01005]
    BRAD285_2027 (rfaD)
Enzymes [BR:bro01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     BRAD285_2027 (rfaD)
Lipopolysaccharide biosynthesis proteins [BR:bro01005]
 Unusual sugar
  BRAD285_2027 (rfaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 NAD_binding_3 KR
Motif
Other DBs
NCBI-ProteinID: SMX57175
UniProt: A0A1Y6KBS7
Position
1930039..1931019
Genome map
AA seq 326 aa AA seqDB search
MLLVTGGAGFIGSNLVAALNDAGRTDVVVCDTLGSEGKWRNLAKRQLADVVPPSDLDAWL
KGRRLDAVLHMGAISATTVVDGDLVMERNFRSSLRLLDWCTANTTPFIYASSAATYGDGA
QGFVDDPSLDALKTLRPMNLYGWSKHLFDMAIAARAERGERLPPQYAGLKFFNVFGPNEY
HKGSMMSVLTRRFDEIKAGQPLQLFKSHREGIADGDQRRDFIYVDDVVRVMLWLLATPSV
SGLFNVGTGQARSFKDMMLAVYATLGATPRIEYVDMPESIRGSYQYFTQSHVDRLLAAGY
NGGFTRLEDAVAFYVRDYLDSADRFR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgttgctggtgactggcggcgccgggtttatcggatcgaatctggtggcggcgctgaac
gacgccggccgcaccgacgtcgtcgtctgcgacacgctcggcagcgagggcaagtggcgc
aatctggccaagcggcagctggccgatgtcgtgccgccgtccgatctggacgcctggctg
aagggccggaggctcgacgccgtcctgcacatgggcgcgatctccgcgaccacggtcgtc
gacggcgacctcgtgatggagcgtaattttcgcagttccttgcgcctgctcgactggtgc
acggcgaataccacgccgttcatctacgcgtcctcggcggccacctatggcgacggcgcg
caggggttcgtcgatgatccgtcgctcgacgcgctgaagacgctgcggccaatgaacctc
tatggctggagcaagcatctgttcgacatggcgatcgccgcacgcgccgagcgcggcgag
cgtctgccgccgcaatatgccggcttgaagttcttcaacgtgttcggtcccaacgagtac
cacaagggatcgatgatgagcgtgctgacgcgccgcttcgatgagatcaaggccgggcag
ccccttcagctattcaagtcgcatcgcgagggcatcgccgacggcgaccagcgccgcgac
ttcatctatgtcgacgatgtcgtgcgcgtgatgctgtggctattggccacgccgtcggtc
tccgggctcttcaacgtcggcacggggcaggcgcgcagcttcaaggacatgatgctggcg
gtctatgcgacgctcggagccacgccgcggatcgagtacgtcgacatgcccgaatcgatt
cgcgggagctaccagtacttcacccagagccatgtcgaccgcctgctggccgcaggctac
aacggcggcttcacacggctcgaggatgcggtggccttctatgtccgagattatctcgat
tccgccgaccgcttccgctaa

DBGET integrated database retrieval system