KEGG   Bradyrhizobium sp. ORS 285: BRAD285_2452Help
Entry
BRAD285_2452      CDS       T04956                                 

Definition
(GenBank) 2-haloacid halidohydrolase IVa
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
bro  Bradyrhizobium sp. ORS 285
Pathway
bro00361  Chlorocyclohexane and chlorobenzene degradation
bro00625  Chloroalkane and chloroalkene degradation
bro01100  Metabolic pathways
bro01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bro00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BRAD285_2452
   00361 Chlorocyclohexane and chlorobenzene degradation
    BRAD285_2452
Enzymes [BR:bro01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     BRAD285_2452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 CbiJ DUF3328
Motif
Other DBs
NCBI-ProteinID: SMX57542
UniProt: A0A1Y6KCV5
Position
complement(2366459..2367127)
Genome map
AA seq 222 aa AA seqDB search
MSRFRPKYVTFDCYGTLTNFQMAEAARDLYSATLPEPAMTEFVKVFSAYRLDEVLGAWKP
YAEVVSNALARSCRKIGIAFKPEDADMVYQRVPTWGPHPDVPAGLAKVAKEIPLVILSNA
MNVQIPFNVAKLGAPFHAVFTAEQAQSYKPRMRGFEYMFDMLGCGPEDITHCSSSFRYDL
MTAHDLGIESKVWVNRGHEPANPYYGYTEIKDVSELPGVFGL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgagccgctttcgcccgaaatacgtgaccttcgactgctacggtacgctgaccaatttc
cagatggcggaggccgcgcgcgatctctacagcgcaacgctccccgagccggcgatgacc
gaattcgtgaaggtcttctcggcctaccgcctcgacgaagtcctcggcgcctggaagccc
tatgccgaggtcgtcagcaatgcgctggcgcgcagctgccgcaagatcggcatcgccttc
aagccggaggacgccgacatggtctatcagcgcgtgccgacctggggaccgcatccggac
gtgccggcggggctcgccaaggtggccaaggagattccgctggtcattctctccaacgcc
atgaacgtgcagatccccttcaacgtcgccaagctcggcgcccccttccatgccgtgttc
accgccgagcaggcgcagtcctacaagccgcggatgcgcggcttcgaatacatgttcgac
atgctcggctgcggcccggaggacatcacgcactgctcctcctcgtttcgctacgatctg
atgaccgcgcacgatctcggcatcgaaagcaaggtctgggtcaaccgcggtcatgagccg
gccaatccctattacggctacaccgagatcaaggacgtctccgagctgcccggcgtgttc
ggtctctaa

DBGET integrated database retrieval system