KEGG   Bradyrhizobium sp. ORS 285: BRAD285_2854Help
Entry
BRAD285_2854      CDS       T04956                                 

Definition
(GenBank) putative 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bro  Bradyrhizobium sp. ORS 285
Pathway
bro00071  Fatty acid degradation
bro00072  Synthesis and degradation of ketone bodies
bro00280  Valine, leucine and isoleucine degradation
bro00310  Lysine degradation
bro00362  Benzoate degradation
bro00380  Tryptophan metabolism
bro00620  Pyruvate metabolism
bro00630  Glyoxylate and dicarboxylate metabolism
bro00640  Propanoate metabolism
bro00650  Butanoate metabolism
bro00900  Terpenoid backbone biosynthesis
bro01100  Metabolic pathways
bro01110  Biosynthesis of secondary metabolites
bro01120  Microbial metabolism in diverse environments
bro01130  Biosynthesis of antibiotics
bro01200  Carbon metabolism
bro01212  Fatty acid metabolism
bro02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BRAD285_2854
   00630 Glyoxylate and dicarboxylate metabolism
    BRAD285_2854
   00640 Propanoate metabolism
    BRAD285_2854
   00650 Butanoate metabolism
    BRAD285_2854
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BRAD285_2854
   00072 Synthesis and degradation of ketone bodies
    BRAD285_2854
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BRAD285_2854
   00310 Lysine degradation
    BRAD285_2854
   00380 Tryptophan metabolism
    BRAD285_2854
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BRAD285_2854
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BRAD285_2854
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BRAD285_2854
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bro04147]
    BRAD285_2854
Enzymes [BR:bro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BRAD285_2854
Exosome [BR:bro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BRAD285_2854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: SMX57906
UniProt: A0A1Y6KE93
Position
2778711..2779880
Genome map
AA seq 389 aa AA seqDB search
MTASIVGWAHTPFGKFDAETVESLVVKVANEALADAGISAGDVDEIVLGHFNAGFSPQDF
TASLVLQADPALRFKPATRVENACATGSAAVHQGIRAIAAGAAKIVLVVGVEQMTRTPGP
EIGKNLLKASYLPEDGDTVGGFAGVFGKIAQGYFQKYGDQSDALALIAAKNHKNGVANPF
AQMRKDFGFEFCRSDSEKNPYVAGPLKRTDCSLVSDGAAALVLTDSETAKKFAKAVNVRA
TAHAQDFLPMSKRDILAFEGCTVAWQRALEKAGVTLSDLSFVETHDCFTVAELIEYEAMG
LTPRGQGARAIKEGWTLKDGKLPVNPSGGLKAKGHPIGATGVSMHVMTAMQLTGTAPEGM
QLANAKLGGIFNMGGAAVANYVSILEPVK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccagcatcgtcggatgggcgcatacgccgttcggaaagttcgacgccgagacc
gtcgagagcctcgtcgtcaaggtcgccaatgaggcgctggccgacgccggcatctcggcc
ggcgatgtcgatgagatcgtgctcggccatttcaacgccggcttctcaccccaggacttt
accgcctcgctggtgctgcaggccgatcccgccttgcgcttcaagccggcgacccgcgtc
gagaacgcctgcgccacgggctcggccgccgtccaccagggtatccgcgcgatcgccgcc
ggtgccgccaagatcgtgctcgtcgtcggcgtcgagcagatgacccgcacgccgggcccg
gagatcggcaagaacctgctcaaggcctcctatctgccggaagatggcgacacggtcggc
ggcttcgccggcgtgttcggcaagatcgcgcagggctatttccagaagtatggagaccag
tccgacgcgctggcgctgatcgccgccaagaaccacaagaacggcgtcgccaatcccttc
gcgcagatgcgcaaggatttcggcttcgagttctgccgctccgatagcgagaagaacccg
tatgtcgccggccccctgaagcgcaccgactgctcgctcgtgtccgacggcgccgccgcg
ctggtgctgaccgacagcgagacggcgaagaagttcgctaaggcggtgaatgtccgcgcc
accgcgcacgcgcaggatttcctgccgatgagcaagcgcgacatcctcgccttcgagggc
tgcacggtggcctggcagcgtgcgctggagaaggccggcgtcaccctgtccgatctctcc
ttcgtcgagacccatgactgcttcaccgtcgccgagctcatcgagtacgaagcgatgggc
ctgacgcccagggggcagggcgcccgcgccatcaaggaaggctggacgctcaaggacggc
aagctgccggtcaacccgtccggcggcctcaaggccaagggccatcccattggcgccacc
ggcgtctccatgcacgtgatgaccgccatgcagctcacgggcacggcgcccgagggcatg
cagctcgccaacgccaagctcggcggcatcttcaacatgggcggcgccgcggtggcgaac
tacgtgtcgatcctcgagccggtgaagtag

DBGET integrated database retrieval system