KEGG   Bradyrhizobium sp. ORS 285: BRAD285_3854Help
Entry
BRAD285_3854      CDS       T04956                                 

Definition
(GenBank) conserved protein of unknown function; putative THIJ/PFPI FAMILY PROTEIN
  KO
K18199  cyclohexyl-isocyanide hydratase [EC:4.2.1.103]
Organism
bro  Bradyrhizobium sp. ORS 285
Pathway
bro00930  Caprolactam degradation
Brite
KEGG Orthology (KO) [BR:bro00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    BRAD285_3854
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bro01002]
    BRAD285_3854
Enzymes [BR:bro01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.103  cyclohexyl-isocyanide hydratase
     BRAD285_3854
Peptidases [BR:bro01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   BRAD285_3854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: SMX58788
UniProt: A0A1Y6KIP5
Position
3825481..3826176
Genome map
AA seq 231 aa AA seqDB search
MAEPLSIALVLFPQVTQLDLTGPVQVFSSVPGATLHLVWKRIEPIPTDSVLTLLPTTTFA
ECPQADVICIPGGFGVDAILDDAEVIGFIRRQAEDAKYITSVCTGSLALGAAGLLRGYRA
ATHWSARECLPLFGATISTERVCIDRNRVTGGGVTAGIDFALTLVSQLVDRATAEAIQLR
LEYNPAPPFAAGSPDTAPPEVVSRMLERIAPFRQRRVAAAERAAAMLRGSA
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaccgctttcgatcgctctcgtgctgtttccccaggtcacccagctcgatctc
accggcccggtacaggtgttctcgagcgtgcccggcgcgacgctgcatttggtctggaag
cggatcgagccgattccgaccgactccgttctcacgctgctgccgacgacgacgtttgcc
gagtgcccgcaggccgacgtgatctgcatccccggcggcttcggcgtcgatgccattctg
gacgatgccgaagtcatcggcttcatccgccgccaggccgaagacgccaaatacatcacc
tcggtctgcaccggctcgctcgcgctcggagccgctggcctgctgaggggctatcgcgct
gcgacccattggagcgcgcgcgagtgcctgccgctgttcggcgccaccatcagcaccgag
cgcgtctgcatcgaccgcaaccgcgtgaccggcggcggtgtcaccgccggcatcgacttc
gcgctgaccctggtgtcgcaactggtcgaccgcgcgacggcggaggcgatccagctcagg
ctcgaatacaatccggcgccaccgttcgcggccggctcgcccgacaccgcaccgcccgag
gtcgtgtcacgaatgctggagcgaatcgcccccttccgccagcggcgtgtcgcggcggcc
gagcgcgccgcggccatgctcaggggcagcgcctag

DBGET integrated database retrieval system