KEGG   Bradyrhizobium sp. ORS 285: BRAD285_5746Help
Entry
BRAD285_5746      CDS       T04956                                 

Gene name
cbbF
Definition
(GenBank) D-fructose-1,6-bisphosphatase protein
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
bro  Bradyrhizobium sp. ORS 285
Pathway
bro00010  Glycolysis / Gluconeogenesis
bro00030  Pentose phosphate pathway
bro00051  Fructose and mannose metabolism
bro00680  Methane metabolism
bro00710  Carbon fixation in photosynthetic organisms
bro01100  Metabolic pathways
bro01110  Biosynthesis of secondary metabolites
bro01120  Microbial metabolism in diverse environments
bro01130  Biosynthesis of antibiotics
bro01200  Carbon metabolism
Module
bro_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bro_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bro_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bro_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:bro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BRAD285_5746 (cbbF)
   00030 Pentose phosphate pathway
    BRAD285_5746 (cbbF)
   00051 Fructose and mannose metabolism
    BRAD285_5746 (cbbF)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BRAD285_5746 (cbbF)
   00680 Methane metabolism
    BRAD285_5746 (cbbF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bro04147]
    BRAD285_5746 (cbbF)
Enzymes [BR:bro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     BRAD285_5746 (cbbF)
Exosome [BR:bro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BRAD285_5746 (cbbF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase Inositol_P
Motif
Other DBs
NCBI-ProteinID: SMX60531
UniProt: A0A1Y6KLC3
Position
complement(5755585..5756622)
Genome map
AA seq 345 aa AA seqDB search
MDHELNHHQTLQAHLASHGADADCAAVIEALADAARELARQIAIAPLSGVDEGAATVNTD
GDIQKALDIVADNLMRDALRRAPVAGILSEEGDRPETVNEAAPLCVAIDPLDGSSNLQNN
ISVGTIFSIRPRGRDVLSSFFEPGTAQLAAGFFVYGPQTCLVLAIDRRVDLYVLHPTLHE
FILAKSGIRIPQDTPEFAINASNRRHWSGTVRNYVDECLSGAAGPRGRDFNMRWIASLVA
EAYRILMRGGVFLYPADSRPGYREGRLRLVYEAHPMALIMEWAGGSASSGRARILELSAR
SPHQRAPLIMGDVRLVRDVDQLHEGVEPLFETSDAPLFARRGLFR
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggatcacgagctaaatcatcatcagacattgcaggcccatctcgcgtcgcacggggcg
gatgctgattgcgccgctgtcatcgaggccctcgccgacgccgcccgcgagctggcgcgg
cagattgccatcgcgccgctgtccggcgtcgacgaaggcgccgccaccgtcaacaccgac
ggcgacatccagaaggcgctcgacatcgtcgccgacaatctgatgcgcgacgcactgcgc
cgggcgccggtcgccggcattctgtcggaagagggcgaccggccggaaacggtcaacgag
gctgccccactttgcgtggcgatcgatccgctcgacggctcctcgaacctgcagaacaac
atctcggtcggaaccatcttctcgatccggccgcgcggccgcgacgtgctgtccagcttc
ttcgagcccggcaccgcccagctcgccgccggcttcttcgtctacggaccgcagacctgc
ctcgtgctcgcgatcgaccgccgcgtcgacctctacgtgctgcatccgaccttgcacgag
ttcatcctcgccaagtcgggcatccgcatcccgcaggataccccggaattcgcgatcaac
gcctcgaaccgtcggcactggagcggcaccgtccgcaactatgtcgatgagtgcctgtcg
ggcgctgcgggcccgcgcggccgcgacttcaacatgcgctggatcgcctcgctggtggcg
gaggcctaccgcatcctgatgcgtggcggcgtgttcctctatcccgccgattcccgcccg
ggctatcgcgagggccggctgcggctggtgtacgaagcgcatccgatggcgctgatcatg
gaatgggccggcggctcggcctcgagcggccgcgcgcgcatcctcgaattgtcggcgcgc
tcgccgcaccaacgggcgccgctgatcatgggcgacgtccgcctcgtgcgcgatgtcgac
cagctgcatgaaggtgtcgagccgctgttcgagacgagcgatgcgcccctgttcgcccgc
cgaggcctgttccgctga

DBGET integrated database retrieval system