KEGG   Bradyrhizobium sp. ORS 285: BRAD285_6011Help
Entry
BRAD285_6011      CDS       T04956                                 

Definition
(GenBank) putative Two-component transcriptional regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
bro  Bradyrhizobium sp. ORS 285
Pathway
bro02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BRAD285_6011
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bro02022]
    BRAD285_6011
Two-component system [BR:bro02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   BRAD285_6011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C GerE Thump_like
Motif
Other DBs
NCBI-ProteinID: SMX60778
UniProt: A0A1Y6KPE3
Position
6019732..6020463
Genome map
AA seq 243 aa AA seqDB search
MTVTITAIAPHQPQTPADDAPHLLLVDDDRRIRDLLSRFLRGEGYRVTTAASASDARAKL
TGLHFDLLILDVMMPGESGFDLARYIRTQSSVPIVMLTARAEPESRIEGLQLGADDYVAK
PFEPRELALRIGNILKRAAPPPAEEVIEQISFGPFVYHLARGELKQGEEIVHLTDREREM
LRILATARGETVPRGALTGNGTVNERAVDVQINRLRRKLEIDPANPLFLQAVRGIGYRLM
TSG
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtgacgatcaccgccatcgccccgcatcagccgcagacgccggctgacgacgcg
ccgcatctgctgctcgtcgacgacgaccgccgcatccgcgatctgctgtcgcgcttcctg
cgcggcgagggctatcgcgtcaccacggcggcgagcgcgagcgatgcacgcgccaagctg
accggcctgcatttcgatctcctgatcctcgacgtcatgatgcccggcgaaagcggcttc
gacctcgcccgctatatccgcacgcagtcgtccgtgccgatcgtgatgctgaccgcgcgc
gcggagcccgagagccgcatcgaggggctgcagctcggcgccgacgattacgtcgccaaa
ccgttcgagccgcgcgagctcgcgctgcgcatcggcaacatcctcaagcgcgccgcgccg
ccgccggccgaggaagtcatcgagcagatcagcttcggcccgttcgtctatcatctggcg
cgcggcgaattgaaacagggcgaggagatcgtccacctcaccgatcgcgagcgcgagatg
ctgcgcatcctcgccaccgcccgcggcgagaccgtgccgcgcggcgcgctgaccggcaac
ggcaccgtcaacgagcgcgccgtcgacgtccagatcaaccgcctgcgccgcaagctcgag
atcgaccccgccaacccgctgttcctgcaagccgtgcgcggcatcggctatcggctgatg
acctcgggctga

DBGET integrated database retrieval system