KEGG   Bradyrhizobium sp. ORS 285: BRAD285_7539Help
Entry
BRAD285_7539      CDS       T04956                                 

Gene name
phhB
Definition
(GenBank) Pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
bro  Bradyrhizobium sp. ORS 285
Pathway
bro00790  Folate biosynthesis
bro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bro00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BRAD285_7539 (phhB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bro04147]
    BRAD285_7539 (phhB)
Enzymes [BR:bro01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     BRAD285_7539 (phhB)
Exosome [BR:bro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BRAD285_7539 (phhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a Sun2_CC2 IF-2
Motif
Other DBs
NCBI-ProteinID: SMX62122
UniProt: A0A1Y6KQT7
Position
complement(7549695..7549997)
Genome map
AA seq 100 aa AA seqDB search
MVERLSSETRVAALKALPGWSALDGRDAITRIFTFRDFNEAFGFMTRVALVAEKHDHHPE
WRNVYRTVEVVLSTHDAGGLTERDIALAQAMDAIAAAISS
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atggtggagcgattgtcatccgagacccgcgtcgcggccctgaaggcccttcccggctgg
tcggcgctcgatggtcgcgatgccatcacccgcattttcacctttcgcgatttcaacgag
gcgttcggcttcatgacccgcgtcgcgctggtcgccgaaaagcatgatcatcatccggag
tggcgcaacgtctaccgcaccgtcgaggtggtgctgtcgacccatgacgcaggcggactg
acggagcgcgacatcgcgctggcgcaggcgatggacgcgatcgcggcggcgatcagcagc
tga

DBGET integrated database retrieval system