KEGG   Brassica rapa (field mustard): 103828183Help
Entry
103828183         CDS       T03449                                 

Definition
(RefSeq) tyrosine decarboxylase 1-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00350  Tyrosine metabolism
brp00360  Phenylalanine metabolism
brp00380  Tryptophan metabolism
brp00901  Indole alkaloid biosynthesis
brp00950  Isoquinoline alkaloid biosynthesis
brp00965  Betalain biosynthesis
brp01100  Metabolic pathways
brp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    103828183
   00360 Phenylalanine metabolism
    103828183
   00380 Tryptophan metabolism
    103828183
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    103828183
   00950 Isoquinoline alkaloid biosynthesis
    103828183
   00965 Betalain biosynthesis
    103828183
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:brp04147]
    103828183
Enzymes [BR:brp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     103828183
    4.1.1.105  L-tryptophan decarboxylase
     103828183
Exosome [BR:brp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103828183
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2 Aminotran_5
Motif
Other DBs
NCBI-GeneID: 103828183
NCBI-ProteinID: XP_009102041
Position
A7
AA seq 491 aa AA seqDB search
MENGRSNNALKPMDSEQLREYGHRMVDFVADYYKTIETFPVLSQVQPGYLHNLLPESAPD
HPETVEQVLDDVKAKILPGVTHWQSPSFFAYFPINGSIAGFLGEMLSAGLNTMSFSWVAS
PAATELEIVVVDWVAKLLNLPEQFLSKGNGGGVIQGSACEAILVVMIAARDKVLRSVGKK
ALEKLVVYSSDQTHSSLQKACQLAGIHLENCRVLKTDSSTNYALRPESLQEAVSKDLEAG
LIPFFLCGTVGTTSSTAVDPLAALGKIAKSNEMWFHIDAAYAGSACICPEYRQYIDGVET
ADSFDMNAHKWLLTNFECSLLWVKDQSALTEALSTNPEYLKNKASQANLVVDYKDWQIPL
GRRFRSLKLWMVLRLYGAENLKSYIRNHIKLAKIFEQLVSKDPNFEVVTPRIFSLVCFRI
AAVDNDEKKCNNLNRSLLDAVNSSGKLLFSHTILSEKFVLRFAIGAPLTEEKHVKEAWKV
IQEEASFLLSK
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatggtcgtagcaacaacgcgttgaagccgatggactcagagcaactgagagag
tacggacatcgaatggtggatttcgttgctgattattacaaaaccatcgagactttccct
gtccttagccaagttcagcctggttatcttcataatcttttgcctgagtcagccccagac
catcctgaaacggtggaacaagttcttgacgatgtcaaggcgaagatattgcctggagta
actcattggcaaagccctagtttctttgcttacttccctattaacggcagcattgcaggg
ttcttgggtgagatgttgagtgctggtcttaatactatgagttttagttgggttgcttct
ccagctgcaactgagctcgaaattgtcgttgttgattgggttgcaaaactgctcaacctg
ccagagcagtttctatccaaaggaaatggaggtggagtaatccaagggtcagcttgtgaa
gctattctcgttgttatgattgctgcccgcgataaggtcttaagaagcgttggtaagaaa
gcacttgagaagcttgttgtctactcctctgaccagacacattcatctttacagaaagct
tgccagctagccggtatccatctagagaattgcagggtcctgaaaacagattcatctaca
aattacgctctgcgccctgaatcgcttcaagaagctgtttctaaggatcttgaagctgga
ttgattccattcttcttatgtggcactgttggaacaacttcttcaacagcagttgatcca
ctagcagcactgggaaagattgcaaagagcaatgagatgtggtttcacatcgatgcagcg
tatgctggaagtgcttgtatatgtccagagtatagacagtacattgacggagtagaaact
gcagactcttttgacatgaatgctcacaaatggttgctcactaatttcgagtgttcccta
ctttgggtgaaggatcaatctgctctcactgaagctctttcaacaaatccagagtatctc
aaaaacaaagcatctcaggcaaacttggttgttgattacaaagattggcaaatccctctt
ggacgacgattcaggtcactgaaactatggatggttttacggctctatggagctgagaac
cttaagagctatataagaaaccatatcaaactggctaaaatattcgaacaacttgtctcc
aaagatcctaactttgaggttgtgactcctaggatcttttctctggtctgtttccgtata
gcggctgttgataacgatgaaaagaagtgcaacaacctaaaccgcagcctcctagacgca
gtgaactcttcaggaaaactcttattttctcacactatattatcggaaaaattcgtacta
cgtttcgccataggagcgccattgacggaggagaagcacgtgaaggaggcatggaaggtt
atccaggaagaagcatcattcttgctttccaaataa

DBGET integrated database retrieval system