KEGG   Brassica rapa (field mustard): 103828585Help
Entry
103828585         CDS       T03449                                 

Definition
(RefSeq) beta-glucosidase 9-like
  KO
K01188  beta-glucosidase [EC:3.2.1.21]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00460  Cyanoamino acid metabolism
brp00500  Starch and sucrose metabolism
brp00940  Phenylpropanoid biosynthesis
brp01100  Metabolic pathways
brp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    103828585
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    103828585
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    103828585
Enzymes [BR:brp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     103828585
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase FAM165
Motif
Other DBs
NCBI-GeneID: 103828585
NCBI-ProteinID: XP_018508678
UniProt: A0A397YQE7
Position
A7
AA seq 471 aa AA seqDB search
MEHVLLLITILLCLAFSGRCIDAYSRNDFPKGFLFGSAFSAFQWEGAVDEDGRMPSIWDT
YIRSNNAPSGDIACDGYHKYKEDVRLMYDMGLDAFRLSISWSRLIPGGRGPVNPKGLLFY
KNLIDELTRHGIEPHVTLYHNDLPQALEDEYGGWIDRRIIDDFTAFADVCFRELGNKVKF
WSTINEPNMSALGGYDLGFMPPEHCSAPFGHVNCSRGNSSTEPYIAVHNMLLAHASTARL
YKQKYKGEQNGSVGMTCFSYWVVPFSSSKEDEMATQIAKDFFLGWILHPLVFGDYPDTMK
RLVGKRLPSFSEEETKVVKDSSDFIGVIHYTTMTAAHVSTFQQGDFSADMNALVSPFGNS
TLVKYDVLPWGLEGVLAYIKENYGNPPVYILENGQSTNHYSSLDDVERVEYLQAYIGAVL
DSVRNGSKTKGYFQWSFMDLYEFLDTNYTYGLYYVNFSDPERKRSPKTSAF
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggaacatgttctgctcctcattaccattttattgtgtttggctttctccgggagatgc
atcgatgcttacagcaggaatgatttcccgaagggattcctattcggatcggccttttct
gcttttcagtgggaaggagcggttgatgaagacgggaggatgcctagcatatgggataca
tacattcgctctaataacgcacctagcggagatatagcatgtgatgggtatcataaatat
aaggaggacgtaaggctgatgtatgacatgggtttagatgcattccgactctccatctcg
tggtcgcgacttataccaggtggaagaggacctgtgaatccaaagggtttactattctac
aaaaacctcattgatgagctcacaagacatggaattgaaccgcatgttacgttgtatcac
aatgatcttcctcaggctcttgaagatgaatacggaggatggattgaccgcagaatcatc
gatgacttcacagcttttgcagacgtttgcttcagagagttagggaacaaagtgaaattc
tggtcaacaattaatgaacccaatatgtcagcattgggaggttacgacttgggatttatg
cctcctgagcactgttctgctccatttggacatgtcaactgttccagaggaaactcctca
actgagccatatattgcggtccataacatgttgcttgcacacgcatctacagcgagattg
tacaagcaaaagtataagggtgaacagaatggatcagttggtatgacatgcttttcatac
tgggtagttccttttagtagctcaaaagaggacgagatggcaactcagatagccaaagat
ttctttttaggctggattttgcacccactggtgtttggggactatccagatacgatgaag
agactggtgggcaagagattgccaagtttttcggaagaagaaacaaaagtcgttaaagac
tcgtctgacttcataggagtcatacactatactacaatgaccgccgcacacgtatccact
ttccaacaaggggattttagtgcagacatgaatgctttagttagcccctttgggaattct
acactggtcaagtatgatgtgctaccatggggtcttgaaggagtgttggcatacataaag
gagaactatggcaatccacctgtctacattcttgaaaacggtcaatccaccaaccactat
tcatcacttgacgacgtggaaagagttgaataccttcaggcttatatcggtgctgtactt
gattcagtgaggaatggctcaaagacgaaaggctacttccagtggtcgtttatggatttg
tacgagtttcttgataccaattacacatatggattatactatgtgaatttcagcgatccg
gaacgtaaaaggtctccgaagacctctgccttttag

DBGET integrated database retrieval system