KEGG   Brassica rapa (field mustard): 103830750Help
Entry
103830750         CDS       T03449                                 

Definition
(RefSeq) monoglyceride lipase-like
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00561  Glycerolipid metabolism
brp01100  Metabolic pathways
Module
brp_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    103830750
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:brp01002]
    103830750
Enzymes [BR:brp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     103830750
Peptidases [BR:brp01002]
 Serine Peptidases
  Family S33
   103830750
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 LIDHydrolase FSH1 Peptidase_S9 Peptidase_S15
Motif
Other DBs
NCBI-GeneID: 103830750
NCBI-ProteinID: XP_009104809
Position
A7
AA seq 465 aa AA seqDB search
MICSSKGTILIYRGKHSTFRLPVTGSSLSYKNRFNNKLPITVTAFQRSSSSLPSSSMAVE
TMSDTSTLLLTSGASGRVRALFSMRELKRLVTIIHALILFILLPFRVVVWRRRTGAVVIR
DEKQERKVWSPPQIVVRKRGAGGSESGCSVAPPSVPAAVVDLEVAVRRELAMRRVLEDDG
GDGSSVREFSLFPTKRGDTLFTQSWSPVSPNHRGLIVLLHGLNEHSGRYSDFAKQLNANG
FKVYGIDWIGHGGSDGLHAYVPSLDYAVEDLKSFLEKVFTENPGLPCFCIGHSTGGAIIL
KAMLDPMIESRVSGIVLTSPAVGVQPSHPIFTVLAPIVAFLLPRYQFSAANKKGMPVSRD
PQALVTKYSDPLVFTGSIRVKTGYEILRIAAHLQQNLNKVKVPFLVMHGTADTVTDPNAS
KRLYEEASSSDKSIKLFDGLLHDLLFEPEREIIAGVILDWLNQRV
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgatctgttcaagcaaaggaacgatcttaatatacagaggaaaacattcaacctttaga
ttacccgttacaggctcttccttaagttacaagaatcgatttaataacaaacttccgatc
actgtcacagcttttcaacgatcatcatcatcgttaccttcatcgtcaatggcggtggaa
acaatgtcagatacatcaactttgcttctgacgtcgggagcaagcggccgcgttagagcc
ctcttctccatgcgagagctcaagcgtctcgtcacgatcatccacgcgctgatcctcttc
attctcctcccgtttcgcgtcgttgtttggaggcggaggaccggagcggtggttatcaga
gacgagaaacaggagaggaaggtctggtctccgccgcagatcgtggtcaggaagaggggc
gccggaggaagcgaaagcggatgcagcgttgcgcctccgtcggttccggcggcggtggtg
gacttggaggttgcggttagacgtgagctcgcgatgaggagagtgttggaggatgacggc
ggcgatggaagctccgtcagagagttttcgcttttcccgacgaagagaggagatacgttg
tttactcagtcatggtcacctgtttcccctaatcacaggggacttattgttctgctacat
ggactaaatgagcatagtggcaggtatagtgattttgcaaagcagctaaatgctaatggg
ttcaaggtctatggaatcgattggataggtcatggtggaagcgatggacttcatgcttat
gtcccttcccttgactacgctgtcgaagatttgaaatcatttcttgaaaaggtttttacg
gagaatccaggactcccttgtttctgcattggacactcaacaggaggagcaatcatcctc
aaggctatgctagatccaatgattgagtctcgagtctcgggcattgtactgacttcacct
gctgttggagtccaaccatcccatcctatctttactgttcttgctccaatcgttgcgttc
ctcctgccaaggtaccagttcagtgcagcaaacaagaaaggaatgccggtctctcgtgat
ccacaagctctcgtcaccaaatactctgacccgctagtcttcaccggatccatccgggtt
aaaaccggctacgagatccttagaatcgccgctcacttgcaacaaaacctgaacaaagtg
aaagtcccttttctggtcatgcacggtacagctgacactgtgactgatcccaacgcctct
aagaggctctacgaggaagcttcttcttcagacaaatcaatcaagctctttgacggactg
ttgcacgatcttctcttcgaacctgagagagaaatcatcgctggagtcatattagattgg
ctaaaccagcgggtttag

DBGET integrated database retrieval system