KEGG   Brassica rapa (field mustard): 103830786Help
Entry
103830786         CDS       T03449                                 

Definition
(RefSeq) putative receptor-like protein kinase At1g72540
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
brp  Brassica rapa (field mustard)
Brite
KEGG Orthology (KO) [BR:brp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:brp01001]
    103830786
Enzymes [BR:brp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103830786
Protein kinases [BR:brp01001]
 Serine/threonine kinases: TKL group
  IRAK family
   103830786
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 103830786
NCBI-ProteinID: XP_009104852
Position
A7
AA seq 396 aa AA seqDB search
MKRIRFSWKNICLPISCINNTNQKTTCTTNPSKERLLLLSKQTSVRSRVYLSDFSNSTIS
LNDLSNSYLIDIHIFTFEELKTITQGFSKYNYLGEGGFGEVYKGFVDNSVKTGLKAQPVA
VKALKREGGQGHREWLAEVVILGQLKHPNLVNLIGYCCEDDHRLLVYEYMERGNLEDHLF
QKYGGALPWLTRVNILLGAAKGLDFLHKEEKPVIYRDFKPSNILLSSDYSSKLSDFGLAT
DGSEADDADFTKSVMGTEGYAAPEYISAGHLTTMSDVFSFGVVLLEMLTARKTVKKYRSQ
RERNLVEWARPMLKDPNKLEQIIDPSLEGRYSLEGIRKAAVLAYQCLSHNAKSRPTMATV
VKTLERILDLKDIQNGPFVYIVPVAGANKVHDIKCN
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaataagattttcctggaagaatatatgtcttcccataagctgcatcaacaac
acaaaccagaagactacatgtacaacaaacccatcaaaggaaagacttcttctgctatcc
aaacaaacctctgtccgaagcagagtctacttgtcggatttcagcaactcaacaatctca
ctcaacgacttgtcaaactcttatctcatagacattcacatcttcacctttgaagagctc
aaaacgatcacacaaggcttctcaaagtataattacctcggtgaaggaggattcggggaa
gtctacaaagggtttgttgataacagcgtcaagactggtttgaaagctcagcctgttgct
gttaaggcattgaaacgagaaggtggacaaggccatagagaatggctggctgaagttgta
atccttggtcagttgaagcatcctaatcttgtgaacttgatcggctactgctgtgaggat
gaccacaggcttctagtttacgaatacatggaacgaggcaatctggaagaccatctgttt
caaaagtatggtggagccttaccttggttaacaagagtgaatattctgcttggtgctgct
aaaggccttgacttccttcacaaggaagagaaacctgtcatttacagagattttaagcct
tccaacatcctcttgagctcggattacagctctaagctttcagatttcggcttagccaca
gatggatcagaggcagatgacgcagactttaccaaaagtgtgatgggcacagaaggctat
gctgctccagaatacatctcagcaggtcatttgacaactatgagcgatgtgttcagcttc
ggtgtggtgcttctggagatgctaacagctagaaagacagtgaagaagtaccggtcacag
agagagaggaacctagtggaatgggctagacccatgttaaaggatcccaacaaacttgaa
cagatcatagacccgagtttagaagggagatactcgcttgaaggcatcagaaaagcagct
gtcttagcgtaccagtgcctgagccacaacgctaagtcacggcctactatggccactgtc
gtcaagaccctagagcgaattttagacctcaaagacatccaaaacggaccgtttgtgtac
attgttccagtagcaggcgcaaataaagttcatgacatcaaatgtaactga

DBGET integrated database retrieval system