KEGG   Brassica rapa (field mustard): 103832374Help
Entry
103832374         CDS       T03449                                 

Definition
(RefSeq) amyrin synthase LUP2
  KO
K15815  lupeol synthase 2 [EC:5.4.99.39 5.4.99.40 5.4.99.41]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00909  Sesquiterpenoid and triterpenoid biosynthesis
brp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    103832374
Enzymes [BR:brp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.39  beta-amyrin synthase
     103832374
    5.4.99.40  alpha-amyrin synthase
     103832374
    5.4.99.41  lupeol synthase
     103832374
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SQHop_cyclase_C SQHop_cyclase_N Prenyltrans Pec_lyase TED_complement
Motif
Other DBs
NCBI-GeneID: 103832374
NCBI-ProteinID: XP_009106614
Position
A7
AA seq 765 aa AA seqDB search
MWKLKIGEGNGEDPYLFSSNNFVGRQTWEFDPKAGTAEERAAVEEARRHFLINRSRVKGC
SDLVWRMQFLKEARFEQAIPPVKIDGNESITHEKSTDALRRGVSFFSALQASDGHWPGEI
TGPLFFLPPLVFCLYITGHLEKVFDEEHRKEMLRHVYCHQNEDGGWGLHIEGRSIMFCTA
LNYICLRILGEGPNGGGENACKRARQWILDRGGVTYIPSWGKIWLSILGLYDWSGTNPMP
PEIWLLPSFLPIHLAKTLCYCRMVYMPMSYLYGKRFVGPVTPLILQLRDELHLQPYEEIN
WNKTRRLYAKEDMYFPHPLIQDLVWDALYILVEPVLTRWPLNKLVREKALRLAMKHIHYE
DENSHYITIGCVEKVLCMLACWIENPNGDYFKKHLARIPDYMWVAEDGMKMQSFGSQLWD
TGFAVQAILASELFDETGNVLKKGHDYIKKSQVRENPSGDFKSMYRHISKGAWTLSDRDH
GWQVSDCTAEALKCCLLLSMMPAEVVGQGIDPEQIYDSVNLLLSFQSENGGMTAWEPVRA
YEWIEFLNPTEFLANLVAEREYVECTSSVIQALILFKQLYPDHRTKEISRSIEKAVQFIE
NEQTPDGSWYGNWGVCFIYGTWFALVGLAAAGKTYKTSPAMRKGVEFLLRTQKDDGGWGE
SYLSCPEKIYIPSEGKRSNLVQTAWAVMGLIHAGQAERDPIPLHRAAKLIINSQMENGDF
PQQEIVGVFMRNCLIHYATYRNTFPLWALAEYRKATFPTHQQLLQ
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atgtggaagttgaagataggagagggaaatggggaagacccttatttgttcagtagcaac
aactttgtcggacgtcaaacatgggaatttgatcccaaagccggcacggcagaggaacga
gcagccgtcgaagaagctcgccggcatttcttgatcaaccgttctcgtgttaaaggctgc
agtgatctcgtgtggagaatgcaatttctaaaagaggcgagattcgagcaagcgatcccg
cctgtgaagatcgacggcaacgaaagcataactcacgagaaatcgacggatgccttacgg
agaggagtttctttcttctcggctttgcaagcctccgacggtcactggcctggagaaatc
accggacctctcttcttcctccctccgttggtgttttgtttgtatatcacaggacacctt
gagaaagtattcgatgaagaacaccgcaaagagatgcttcgtcatgtctattgccatcag
aacgaagatggtggatggggattacacatagaaggtaggagcattatgttctgcaccgcg
ctgaactacatttgcttgcgtatactcggagaaggtcccaatgggggaggagagaacgca
tgtaaacgggcaagacagtggattcttgaccgtggtggtgtcacttatattccttcatgg
gggaaaatatggctatcgatacttggactctatgattggtcaggaaccaatccgatgcct
cctgagatctggttgctaccttcgtttcttccaatacacttagcgaaaactttgtgctat
tgtcggatggtatacatgcctatgtcgtatctatatggaaagaggtttgttggtccagta
acacctcttattttgcaactgcgtgatgaactccatttgcaaccttacgaagaaatcaac
tggaacaaaacacggcgtctatacgcaaaggaggacatgtattttccacatcctttgatt
caagatttggtgtgggatgctctttacattcttgtggagccggtccttacccgttggccg
ttaaataagcttgtgagggaaaaagctcttcggctggcaatgaaacacatacattacgaa
gacgagaatagccattatatcaccatcggttgtgttgagaaggtattgtgcatgcttgct
tgttggattgaaaaccctaatggggactacttcaagaagcatcttgctagaattccagat
tacatgtgggtcgccgaagatggaatgaaaatgcagagctttggtagtcagctatgggat
actgggtttgcggttcaagctatacttgctagtgagctctttgatgaaactggcaatgta
ttgaagaaaggacatgattatattaagaaatctcaggttagagaaaacccttctggtgac
tttaagagcatgtaccgccatatctccaaaggcgcatggactttatctgatcgagatcat
ggatggcaagtttcagattgtactgctgaagctttaaagtgttgcctgctgctctccatg
atgccagctgaagttgttggccagggaatagatcccgaacaaatatacgattctgttaat
ctcttgctatcttttcagagtgagaatggaggtatgactgcatgggagcccgtccgtgcg
tacgaatggattgaatttctaaatcccacggaatttctcgctaatctcgtggccgagcgt
gagtatgtggaatgcacctcatctgttatacaagctttgatcctgttcaagcaactctat
ccagatcacaggacaaaagagataagcaggtccatcgagaaagcggtgcaattcatagaa
aacgaacaaactccagatggttcatggtatgggaattggggagtgtgcttcatttacggc
acatggtttgcgctggtcggcctagcagccgctggcaaaacatataaaaccagtccggct
atgcgtaaaggtgttgagtttttgctcaggacacaaaaagatgatggaggctggggcgaa
agctatctttcatgccctgaaaagatatacataccatcagaagggaaaagatcaaacttg
gtgcaaacagcttgggcagtaatgggtctaattcacgctggacaggctgagagagatcca
atacctcttcaccgtgctgcaaaactcatcatcaattcccaaatggagaatggagatttc
cctcaacaggagatagtaggagtgttcatgaggaattgcttgatacactatgctacctac
agaaacactttcccattatgggcacttgctgagtaccggaaagctaccttcccaactcat
caacaacttctacaatag

DBGET integrated database retrieval system