KEGG   Brassica rapa (field mustard): 103834191Help
Entry
103834191         CDS       T03449                                 

Definition
(RefSeq) sphingosine kinase 2
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00600  Sphingolipid metabolism
brp01100  Metabolic pathways
Module
brp_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    103834191
Enzymes [BR:brp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     103834191
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 103834191
NCBI-ProteinID: XP_009108497
UniProt: A0A397YEQ1
Position
A8
AA seq 476 aa AA seqDB search
MAPAEVIVVDLVLIDGELGMVKLTANGVLEAIEYGEPSRYWTVKKDVLGFVVEGKYIRIK
TVVEREEGICCGEFGGDYSRKDFVFEPFSEDAKNRFCFKLRHYLDSLGRPKRLLVFVNPF
GGKKSAIKIFEKEVKPLFEDADIQLDVQETKYQLHAKEMVRSMDVSKYDGIVCVSGDGVL
VEVVNGLLQRSDWQTVFKLPIGVIPAGTGNGMIKSLLDAVGLQCCANSATISIIRGHTRS
LDVATISQGNTKFFSVLMLAWGLVADIDIESEKFRWMGSARMDFYAIQRIISLRQYNGRV
LFLPAPGFESYGQPTSYRLHKEPPVKVLGYQGPDTKFEDVEWREIKGPFVSVWLHNVPWG
AENNLVAPAAKFSDGFLDLIVVKNCPKLALLSLMTQISEGTHVQSPYVAYLKVKAFALEP
GALVDEPDKEGIIDADGEVLARGRRTYKCEQIALMSYDKLQITVDQGLATLFSPEY
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggctccggcggaggtaatagtcgtcgacctagtcttaatagacggcgaactcgggatg
gtgaagttgaccgccaacggagttttagaagcgatcgagtacggcgaacccagccgttat
tggacggtgaagaaagacgttcttggttttgtcgtggaaggtaaatatattagaataaaa
acagtggtggagagagaggaaggtatctgttgcggagagtttggtggagattactccaga
aaagacttcgtctttgagcctttctctgaagatgctaagaatagattctgcttcaagctc
cgtcactaccttgactctctcggtcggcctaagagattgcttgtgtttgtgaaccctttt
ggcgggaagaaatccgctataaagatatttgaaaaggaagtgaagccattgtttgaagat
gctgacattcaacttgatgttcaagaaacaaagtatcagttgcatgcaaaggaaatggtt
aggtccatggatgtatcaaagtatgatggtattgtttgtgtcagtggcgacggtgtcctt
gttgaggttgtaaatggactgcttcaaagatcagactggcaaactgtcttcaaattgcca
attggagtgatccctgcaggaactggtaatggcatgataaagtcattgttggatgcggtt
gggcttcagtgctgtgcaaatagtgctactatctctattatccgagggcatacacgttct
ttagatgtggcaactatctcacaaggaaataccaaattcttcagcgtcttgatgcttgct
tggggtttagtggctgatatagacatagagtcagagaagttcagatggatgggtagtgct
cgcatggacttctatgccattcaaaggataataagtttaagacaatacaatggtcgagtt
ttgtttctaccggctcctgggtttgaaagctatgggcagccaaccagttaccgtctacac
aaagagccacctgttaaggtgctcggataccaaggacctgatactaaatttgaagatgtt
gaatggagagaaatcaaaggcccttttgtttcagtatggcttcataatgttccctggggt
gctgagaacaatttggttgctcctgcagcaaagttttctgatggcttcctggatttaatt
gtcgtgaaaaactgccctaagctagctttgctatcactaatgacacagataagtgaagga
acacatgttcaatcaccatatgttgcatatctaaaggtgaaggcatttgcacttgaaccg
ggggcactcgtagacgaaccagacaaggaaggaatcatagatgcagatggagaggtgttg
gcaagaggaagacgaacgtataaatgcgagcaaattgctttgatgtcttacgacaagctt
caaattacagttgatcaaggtttagctactctcttctctcctgagtactga

DBGET integrated database retrieval system