KEGG   Brassica rapa (field mustard): 103835367Help
Entry
103835367         CDS       T03449                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH4
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:brp00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    103835367
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:brp03041]
    103835367
Enzymes [BR:brp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     103835367
Spliceosome [BR:brp03041]
 Complex C
  Other components
   Step II factors
    103835367
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C AAA_22 DEAD ABC_tran AAA_30 AAA_19 DUF2075 Helicase_RecD AAA_33 cobW AAA_16 ATPase_2 AAA_14 T2SSE AAA_29 AAA_23 NB-ARC DAP3 MMR_HSR1 SRP54 AAA_7 FtsK_SpoIIIE PHtD_u1 DUF87
Motif
Other DBs
NCBI-GeneID: 103835367
NCBI-ProteinID: XP_009109771
UniProt: A0A397YKW2
Position
A8
AA seq 705 aa AA seqDB search
MANLPILQFEEKIVETVENNPVVVIIGETGSGKSTQLSQILRRHGYTKSGVIAVTQPRRV
AAVSVARRVAQELDVPLGEDVGYAIRFEDRTSNKTRIKYLTDGVLLRESLSNPMLDDYSV
IILDEAHERSLNTDILLGLMKRLVRIRSSNFKVLITSATLDGEKVSRFFSGCPVLNVPGK
LYPVEILYSKERPGSYIESSLKVAIDIHVREPEGDILIFMTGQDDIEKLVSKLEEKVRSL
AEGSCMDAIIYPLHGSLPPEMQVRVFSPPPPNCRRFIVATNIAETSLTVDGVVYVIDSGY
VKQRQYNPSSGMYSLDVTQISKVQANQRAGRAGRTRPGKCYRLYPLAVYRDDLLDATIPE
IQRTSLAGSVLYLKSLDLPDIDILKFDFLDAPSSESLEDALKQLYLIDAIDENGAITNIG
RTMSELPLEPSLSRTLIEANESGCLSQALTVVAMLSAETTLLPGRSKPNEKKRKRDEESN
LPDGSGFGDHIQLLQIFECWDSNNYDIRWCKENDLQVRGMVFVRDVRRQLCQIMQKISKD
RLEVGARGRKSSSREEYRKLRKALCVGNANQVAERMLRHNGFRTLTFKPQLVQVHPASVL
STDQDGMLPNYVVYHELISTTRPFMRNVCSVEMSWVAPIKRKIEKLDVRKLSGGPDNSFK
EPEEKKQNTELSTNTNTAETPTVSENVESRIEAARERFLARKGQK
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatctcccgatccttcaattcgaagagaagatcgtggaaacagttgagaacaac
ccagtcgttgtcatcatcggagaaaccggttccggaaagagcacccagctctctcagatc
ctccgtcgacatggctacactaagtccggcgtcatcgccgtcactcagccccgtcgtgtc
gccgccgtttccgtcgccaggcgagtggcgcaggagcttgatgtacccctaggagaagac
gttggttacgctatacgtttcgaagacagaacatcgaacaaaacacgcattaagtacctc
acagatggagttttactccgtgagagcctctccaatccaatgcttgatgattactctgtg
attatattagatgaagctcacgagaggagtttaaacacggatattctgttgggtctaatg
aagcgtttggttagaatccgttcgtctaacttcaaagttcttataacctctgcaacgctt
gacggggaaaaggtttctcgattcttttcgggatgtcctgtgttgaatgtacctgggaag
ttataccctgtggagatattgtacagcaaagagcgtcccggcagttatattgagtcttct
ctcaaagtggctattgatatacatgttcgtgagccagaaggtgatatcttgatctttatg
actggacaggatgatattgaaaagttagtatcaaagctggaggaaaaagtgagaagctta
gcagagggatcatgtatggatgctattatttatcctcttcatggatctctaccacctgag
atgcaggttcgtgtgtttagtccacctcctccaaactgccggaggtttattgttgctaca
aatattgctgaaacttcccttactgtggacggagttgtgtatgttattgattcggggtat
gtgaagcaaagacaatataacccatcaagtggaatgtattctcttgatgttactcaaatt
agcaaagtgcaagctaaccaacgtgctggacgtgctggtagaacgagacctgggaaatgt
taccgattataccccttggcagtctacagggatgatctccttgatgcaacgattcctgaa
atacaacgaacttcccttgctggaagtgttctttacttgaaatcgttggatcttcctgat
attgacattctcaagttcgattttcttgacgctccatcatctgagtcattagaagacgca
ttgaagcagttgtatctcattgatgcaattgatgagaatggagcaataacaaatattgga
aggacgatgtcagagcttccgctcgagccatcattgtcaaggacattgatagaagcgaat
gaaagtggttgcttatctcaagctctaacagtcgttgctatgttgtcagcagagactact
ctacttcctggtaggagtaaaccaaatgaaaagaagagaaagcgtgatgaagaatctaat
cttcctgatggatccggatttggtgaccacattcaactactacagatttttgaatgttgg
gacagtaataattatgatattcgatggtgcaaagaaaatgacctgcaggtgcgagggatg
gtgtttgtcagagatgttagacgacaattatgtcagattatgcagaaaatatccaaagat
cgattggaagttggagcacgtgggaggaagagctcaagccgagaggagtacaggaagttg
aggaaagctctttgtgtgggtaatgcaaaccaagttgctgagagaatgcttcgtcataat
ggattccgaactcttaccttcaagccccagctagtccaggtgcatccagcatcagtgctg
agtaccgaccaggatggaatgttgccaaattatgtagtgtaccacgagctgatatccacc
acacgaccattcatgcgcaatgtttgttcagttgaaatgtcatgggtggctcccatcaaa
agaaagattgagaaattagatgttagaaaactgagtggtggacctgataactctttcaag
gaacctgaagagaagaagcagaacacagagttgtctacgaacaccaacactgcagaaaca
cctacagtttctgaaaatgtggagagtagaattgaagcagccagagaacggtttcttgct
cgtaaaggacagaaataa

DBGET integrated database retrieval system