KEGG   Brassica rapa (field mustard): 103835599Help
Entry
103835599         CDS       T03449                                 

Definition
(RefSeq) beta-glucosidase 40-like
  KO
K01188  beta-glucosidase [EC:3.2.1.21]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00460  Cyanoamino acid metabolism
brp00500  Starch and sucrose metabolism
brp00940  Phenylpropanoid biosynthesis
brp01100  Metabolic pathways
brp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    103835599
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    103835599
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    103835599
Enzymes [BR:brp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     103835599
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-GeneID: 103835599
NCBI-ProteinID: XP_009110017
Position
A8
AA seq 512 aa AA seqDB search
MNKEIAPRRLTMLTMTIIMMMVTMDKTCICAEEISRGSFPKGFVFGTASSAFQHEGAVKE
DGRGPTIWDTFSHTFGKITDFSNADVAVDQYHRYEEDVQLMKNMGMDAYRFSISWARIFP
NGVGQINEAGIDHYNKLINALLAKGIEPYVTLYHWDLPQALHDRYLGWLNPQIINDFAAY
AEVCFQRFGDRVKHWITFNEPHTFSIQGYDVGLQAPGRCSILFKLTCRSGNSSTEPYIVG
HNVILTHATVSDIYRKKYKATQGGSLGIAFDVMWYEPESNNREDMEAAQRAQDFQLGWFL
DPLMFGDYPSSMRSRVGSRLPVLTGSQSNLIKGSLDFVGINHYTTYYARNNATNLIGTLL
HDAISDSGTVTLPFKGLSAIGDRASSIWLYIVPRGMRSLMNYVKHRYGNPPVYITENGMD
DSNSILIPRKETLKDAKRIRYHHDYLSSLQAAIKEDGCNVKGYFVWSLLDNWEWAAGYSS
RFGLYFVDYRDKLKRYPKDSVHWFTSFLNSTS
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaagagatagctccaagaagattaaccatgttgacgatgaccataattatgatg
atggtgacgatggataagacatgcatatgtgctgaggaaatttccagaggcagtttccca
aaaggctttgtcttcggaactgcttcttctgcttttcagcacgagggggcagtaaaggaa
gatggaagaggtcctaccatatgggacaccttctcccacacttttggtaaaatcacagat
tttagcaacgccgatgttgctgttgatcagtaccaccggtacgaggaagatgtacaactc
atgaagaatatgggaatggacgcttacaggttttccatttcgtgggctcgcatttttcca
aatggtgtaggacaaataaacgaggccggaatcgatcactacaacaaactcataaatgct
ttacttgctaaagggatcgagccgtatgtgacgttgtaccattgggaccttcctcaggca
ctccatgatcgatacctcggttggctaaacccacaaatcataaatgattttgcagcttat
gcagaggtttgtttccagagatttggagatagagtgaagcattggatcacgttcaacgag
ccacacacattctctatacaaggctacgacgttggtctacaagctccaggccgttgctct
attctttttaagctcacttgtcgctccggcaactcatctaccgagccttacatcgttggt
cacaatgttattctaactcacgccaccgtatcagatatctacaggaaaaagtacaaggca
acgcaaggaggttcactaggtatagcgtttgatgtaatgtggtatgaaccggaatcaaac
aatagagaggacatggaagctgcacaaagagctcaagactttcaacttgggtggtttttg
gatccgttgatgtttggggattacccgagttcgatgagaagcagagtcggaagcagattg
ccggtgttaacaggatctcaatcaaatttgataaagggttccctagattttgtagggatt
aatcattacacaacgtactatgcaagaaacaatgccactaatctcattggcactctccta
cacgatgccatttctgattctggaaccgtcactctaccttttaagggtttaagtgcgatt
ggagacagggccagttcgatatggctgtatatagtgcctagagggatgagaagcttgatg
aattacgtcaagcatagatatggaaaccctccagtctatatcactgaaaatggaatggac
gattcaaacagcattctgattccaaggaaagaaactctcaaagatgcaaagagaatcaga
taccaccatgactatctttcgagcttacaagccgcgattaaagaggatggatgcaatgtg
aaaggatacttcgtgtggtcgctgttggataattgggaatgggctgcaggttatagctca
agatttggtctctacttcgttgattatagagacaagcttaagagatatcctaaggattct
gttcattggttcacttctttcttgaactccacttcttga

DBGET integrated database retrieval system