KEGG   Brassica rapa (field mustard): 103836006Help
Entry
103836006         CDS       T03449                                 

Definition
(RefSeq) heat shock 70 kDa protein 5-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
brp  Brassica rapa (field mustard)
Pathway
brp03040  Spliceosome
brp04141  Protein processing in endoplasmic reticulum
brp04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:brp00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    103836006
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103836006
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103836006
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:brp01009]
    103836006
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:brp03041]
    103836006
   03009 Ribosome biogenesis [BR:brp03009]
    103836006
   03110 Chaperones and folding catalysts [BR:brp03110]
    103836006
   04131 Membrane trafficking [BR:brp04131]
    103836006
   03051 Proteasome [BR:brp03051]
    103836006
   03029 Mitochondrial biogenesis [BR:brp03029]
    103836006
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:brp04147]
    103836006
Protein phosphatases and associated proteins [BR:brp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     103836006
Spliceosome [BR:brp03041]
 Complex B
  Other components
   Prp19 complex
    103836006
 Complex C
   Prp19-CDC5 complex
    103836006
Ribosome biogenesis [BR:brp03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    103836006
Chaperones and folding catalysts [BR:brp03110]
 Heat shock proteins
  HSP70 / DNAK
   103836006
Membrane trafficking [BR:brp04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    103836006
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    103836006
Proteasome [BR:brp03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    103836006
Mitochondrial biogenesis [BR:brp03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    103836006
Exosome [BR:brp04147]
 Exosomal proteins
  Proteins found in most exosomes
   103836006
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 103836006
NCBI-ProteinID: XP_009110463
Position
A8
AA seq 650 aa AA seqDB search
MTTKSEKAVGIDLGTTYSCVGVWMNDRVEIIPNDQGNRTTPSYVAFTDTERLIGDSAKNQ
VALNPHNTVFDAKRLIGRRFSDPSVQSDMTHWPFKVVAGPGDKPMIVVTYKNEEKQFSPE
EISSMVLIKMREVAESFLGHAVKNAVVTVPAYFNDSQRQATKDAGSISGLNVLRIINEPT
AAAIAYGLDKKGTQTGERNVLIFDLGGGTFDVSLLTIEEGVFEVKATAGDTHLGGEDFDN
RLVNHFVAEFKRKHKKDISGNARALRRLRTACERAKRTLSSTAQTTIEIDSLHEGVDFYA
TISRARFEEMNMDLFRKCMDPVEKVLRDAKIDKNRVHEVVLVGGSTRIPKIQQLLQDFFN
GKELCKSINPDEAVAYGAAVQAAILTGEGSDKVQDLLLLDVAPLSLGLETAGGVMTVLIP
RNTTVPCKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGTFELKGIPPAPRGVPQIN
VCFDIDANGILNVSAEDKTAGVKNQITITNDKGRLSKEEIEKMVQDAEKYKAEDEQVKKR
VEAKNSLENYAYNMRNTVKDEKLAQKLDQEDKQKIEKAIDETIEWIEGNQLAEVDEFEYK
LKELEGICSPIISKMYQGGTSAGGASDGMAGDGGSGGSGGGQGPKIEEVD
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgacgacaaaatccgagaaagccgtcggaatcgacctcggaacaacatacagctgcgtc
ggagtgtggatgaacgaccgcgtcgagatcatccccaacgaccaaggaaaccgcacaacc
ccctcctacgtcgccttcacagacaccgaacgtttaatcggagactccgcgaagaatcaa
gtcgcgttgaaccctcacaacaccgtcttcgacgcgaagcgtctcatcgggaggagattc
tccgatccttcagtccagagcgacatgactcactggcctttcaaagtcgttgcgggaccc
ggagacaagccgatgatagtcgtcacgtataagaacgaggagaagcagttttctcccgag
gagatatcttcaatggtgctgatcaagatgagggaagtcgctgagtctttcttaggtcac
gcggttaaaaacgccgtcgtaacggtccccgcttattttaacgactctcagagacaggcg
acgaaggacgcgggttcgatctcggggctcaacgttttgaggataattaacgagccaacc
gctgcggctattgcgtacggtttagataaaaaagggacgcaaaccggtgagaggaacgtt
ttgattttcgatcttggaggcgggacgtttgatgtttctctgttaacgattgaagaaggt
gtattcgaagtgaaggctacagctggagatactcacctcggaggtgaagactttgacaat
aggttagttaaccacttcgttgctgagtttaagaggaagcacaagaaggatataagcggg
aacgcgagggcgttgaggaggttgagaacggcttgcgagagagcgaagaggacgctttcg
tcgactgctcagactaccatagagattgattccttgcacgagggggttgacttctacgcg
acgatatcacgcgcgaggtttgaggagatgaacatggatttgttcaggaagtgtatggat
cctgttgagaaagttctaagggatgcaaagattgacaagaaccgtgttcatgaagttgtt
cttgttggaggatcgactaggattccgaagattcagcagcttttgcaagatttttttaat
gggaaggagctttgtaagagtattaaccctgatgaagctgttgcgtacggagctgccgtg
caggccgcgattctgaccggtgaagggagcgataaggtgcaagatctgttacttcttgac
gtggcgccgttgagtcttggacttgagacggcgggtggggtgatgactgtgttgatcccg
aggaacacgactgttccttgtaagaaggagcaggtgttctcgacttattcggataatcag
cctggtgttttgattcaagtgtatgaaggggagcgtgcgaggacgagagacaacaacctt
cttgggacgtttgagctcaaggggatccctcctgctccacgtggagttcctcagatcaat
gtgtgttttgatatagacgcgaacgggatcttgaacgtgtcggcggaggataaaacggca
ggcgtgaagaaccagatcacgatcacgaacgataaagggaggttgagtaaagaggagatt
gagaagatggtgcaagacgcggagaagtataaggcggaggatgagcaggtgaagaagagg
gtcgaggctaagaactcgttggagaattatgcttataatatgaggaacactgttaaggac
gagaagctggcgcagaagctggatcaggaagataagcagaagatagagaaggcgattgat
gagacgattgagtggattgaagggaaccagttggcggaagttgatgagtttgagtataag
ttgaaggagctagaggggatatgtagtccgattatctcgaagatgtatcagggaggtact
agtgctggaggggctagtgatggtatggcaggagacggtgggtcgggtggctctggtggt
ggtcaaggtccaaagattgaagaggtcgattag

DBGET integrated database retrieval system