KEGG   Brassica rapa (field mustard): 103836988Help
Entry
103836988         CDS       T03449                                 

Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase, cytoplasmic
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00030  Pentose phosphate pathway
brp00480  Glutathione metabolism
brp01100  Metabolic pathways
brp01110  Biosynthesis of secondary metabolites
brp01200  Carbon metabolism
Module
brp_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
brp_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    103836988
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103836988
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:brp04147]
    103836988
Enzymes [BR:brp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     103836988
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     103836988
Exosome [BR:brp04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   103836988
  Exosomal proteins of colorectal cancer cells
   103836988
  Exosomal proteins of bladder cancer cells
   103836988
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 103836988
NCBI-ProteinID: XP_009111567
Position
A9
AA seq 516 aa AA seqDB search
MDSGQWHVEKRSTLRNESFLKEYGPVSETGSLSIVVLGASGDLAKKKTFPALFNLYHQGF
LNPDEVHIFGYARSKISDQELRDKIRGYLVDEKNASEKAEALSKFLQLIKYVSGPYDSED
GFKRLDKAISEHEISKKTSEGSSRRLFYLALPPSVYPPVCKMIKAWCTNKSDLGGWTRIV
VEKPFGKDLESAEQLSSQIGALFDEPQIYRIDHYLGKELVQNMLVLRFANRFFLPLWNRD
NIANVQIVFREDFGTEGRGGYFDEYGIIRDIIQNHLLQILCLVAMEKPISLKPEHIRDEK
VKVLQSVMPIKDEEVVLGQYEGYRDDPTVPNDSNTPTFATTILRIDNERWEGVPFILKAG
KAMSSKKADIRIQFKDVPGDIFKCQKQGRNEFVIRLQPSEAMYMKLTVKQPGLEMQTVQS
ELDLSYKQRYQDVSIPEAYERLILDTIKGDQQHFVRRDELKAAWEIFTPLLHRIEKGEVK
SIPYKPGSRGPTEADQLLEKAGYLQTHGYIWIPPTL
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggattctgggcagtggcacgttgagaagaggtccactttgaggaacgaatcgtttcta
aaagagtacggtcctgtctctgaaactggtagcctctccatcgtagttcttggtgcctct
ggtgatctcgccaagaagaagacttttcctgctcttttcaatctctaccaccaggggttt
cttaatccagatgaagttcacatctttggatacgcaaggagtaagatctctgatcaggag
ctgagagacaagatccgtggatatcttgttgatgagaagaatgcttctgagaaagcagaa
gctttgtccaagtttcttcagctgattaagtatgtgagtggcccttatgattctgaggac
gggttcaaaaggctagacaaggcaatctcagagcacgaaatctcgaaaaagacctctgaa
ggatcttccaggagattgttttatcttgcactccctccctctgtataccctcctgtatgc
aagatgatcaaggcatggtgcactaacaaatctgatcttggtggatggacacgtattgtt
gttgagaagccatttggaaaggacttggaatctgcagagcagcttagttcccagattgga
gcactgtttgatgaacctcagatttaccgtattgatcactacctggggaaggaactagtc
caaaacatgctggtccttaggtttgccaaccggttctttctgccgctatggaaccgtgac
aacatagctaacgtgcagattgtgttcagggaagattttggaactgaaggccgtggtgga
tactttgatgaatacggaatcattcgtgatattattcaaaaccacttgctccagattctt
tgccttgttgccatggagaaaccaatctctcttaaacctgagcacatccgtgatgagaaa
gtgaaggttcttcaatcagtgatgcctataaaagatgaagaggtggttcttggacaatac
gaaggttatagagatgatccaactgttccaaacgactcgaacactccaacctttgctaca
acaattcttcgcatagacaatgaaagatgggaaggtgttccatttatactgaaagctgga
aaggcaatgagttcaaagaaggcagatattcgcattcagtttaaggatgttcctggcgac
atattcaaatgtcaaaagcaagggaggaacgagtttgttatacgcttgcaaccttcagag
gccatgtacatgaagctaactgtgaagcaaccgggtctggagatgcaaaccgtgcagagt
gaactagacctatcttacaagcaacgttaccaagatgtctcgattccagaggcttacgag
cgcctcattcttgacacaatcaaaggtgaccagcaacactttgttcgcagagacgagctg
aaggcagcttgggaaatcttcactccactgcttcacaggatagagaagggagaagtgaaa
tcgattccatacaaaccaggaagccgaggtccaacggaagcagaccagctgctagagaaa
gctggttatttgcagactcatggctacatttggatccctcctacgctgtaa

DBGET integrated database retrieval system